{"product_id":"proteintech-25508-1-ap","title":"Proteintech, 25508-1-AP, LYPD6B Polyclonal antibody","description":"Size: 20ul \/ 150ul\nThe LYPD6B (25508-1-AP) by Proteintech is a Polyclonal antibody targeting LYPD6B in IHC, ELISA applications with reactivity to human, mouse samples\n25508-1-AP targets LYPD6B in IHC, ELISA applications and shows reactivity with human, mouse samples.\n\u003cb\u003eTested Applications\u003c\/b\u003e\nPositive IHC detected in: mouse lung tissueNote: suggested antigen retrieval withTE buffer pH 9.0;(*) Alternatively, antigen retrieval may be performed withcitrate buffer pH 6.0\n\u003cb\u003eRecommended dilution\u003c\/b\u003e\nImmunohistochemistry (IHC): IHC : 1:50-1:500\n\u003cb\u003eBackground Information\u003c\/b\u003e\nLYPD6B (containing the Ly6\/PLAUR domain protein 6B), also known as LYPD7, is a member of the Ly6\/uPAR superfamily of proteins. These proteins typically exhibit membrane-anchoring properties and participate in critical cellular signaling and adhesion processes. It is predominantly expressed in the central nervous system. LYPD6B functions as a key regulatory subunit that interacts with and modulates nicotinic acetylcholine receptors (nAChRs), specifically influencing their maturation, stability, and functional properties at synapses. This interaction is crucial for normal cholinergic signaling, which underpins cognitive functions such as learning and memory. Dysfunction of the LYPD6B is associated with multiple neurological disorders. (PMID: 23186997, PMID: 34631692, PMID: 39433742)\n\u003cb\u003eSpecification\u003c\/b\u003e\nTested Reactivity: human, mouse\nHost \/ Isotype: Rabbit \/ IgG\nClass: Polyclonal\nType: Antibody\nImmunogen: CatNo: Ag22008 Product name: Recombinant human LYPD6B protein Source: e coli. -derived, PET30a Tag: 6*His Domain: 1-83 aa of BC040176 Sequence: MLLITLSANLFTVPERSLTTTFSFSRYKSSDRPAHKVSMLLLCHALAIAVVQIVIFSESWAFAKNINFYNVRPPLDPTPFPNS Predict reactive species\nFull Name: LY6\/PLAUR domain containing 6B\nCalculated Molecular Weight: 183 aa, 20 kDa\nGenBank Accession Number: BC040176\nGene Symbol: LYPD6B\nGene ID (NCBI): 130576\nConjugate: Unconjugated\nForm: Liquid\nPurification Method: Antigen affinity purification\nUNIPROT ID: Q8NI32\nStorage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.\nStorage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.","brand":"Proteintech","offers":[{"title":"Default Title","offer_id":46887710163113,"sku":"25508-1-AP","price":0.99,"currency_code":"USD","in_stock":true}],"url":"https:\/\/iright.com\/products\/proteintech-25508-1-ap","provider":"Iright","version":"1.0","type":"link"}