{"product_id":"proteintech-25517-1-ap","title":"Proteintech, 25517-1-AP, NPB Polyclonal antibody","description":"Size: 20ul \/ 150ul\nThe NPB (25517-1-AP) by Proteintech is a Polyclonal antibody targeting NPB in IHC, ELISA applications with reactivity to human samples\n25517-1-AP targets NPB in IHC, ELISA applications and shows reactivity with human samples.\n\u003cb\u003eTested Applications\u003c\/b\u003e\nPositive IHC detected in: human brain tissue,  human colon cancer tissueNote: suggested antigen retrieval withTE buffer pH 9.0;(*) Alternatively, antigen retrieval may be performed withcitrate buffer pH 6.0\n\u003cb\u003eRecommended dilution\u003c\/b\u003e\nImmunohistochemistry (IHC): IHC : 1:20-1:200\n\u003cb\u003eBackground Information\u003c\/b\u003e\nNeuropeptide B, also named as NPB, PPL7 and PPNBP, can be cleaved into two chains, Neuropeptide B-23 (NPB23, hL7) and Neuropeptide B-29 (NPB29, hL7C). It is involved in the regulation of feeding, neuroendocrine system, memory, learning and in the afferent pain pathway. It is widely expressed in central nervous system.\n\u003cb\u003eSpecification\u003c\/b\u003e\nTested Reactivity: human\nHost \/ Isotype: Rabbit \/ IgG\nClass: Polyclonal\nType: Antibody\nImmunogen: CatNo: Ag21877 Product name: Recombinant human NPB protein Source: e coli. -derived, PET28a Tag: 6*His Domain: 53-125 aa of BC126128 Sequence: ARRSQPYRGAEPPGGAGASPELQLHPRLRSLAVCVQDVAPNLQRCERLPDGRGTYQCKANVFLSLRAADCLAA Predict reactive species\nFull Name: neuropeptide B\nCalculated Molecular Weight: 125 aa, 13 kDa\nObserved Molecular Weight: ~10 kDa\nGenBank Accession Number: BC126128\nGene Symbol: NPB\nGene ID (NCBI): 256933\nRRID: AB_2880114\nConjugate: Unconjugated\nForm: Liquid\nPurification Method: Antigen affinity purification\nUNIPROT ID: Q8NG41\nStorage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.\nStorage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.","brand":"Proteintech","offers":[{"title":"Default Title","offer_id":46887740539049,"sku":"25517-1-AP","price":0.99,"currency_code":"USD","in_stock":true}],"url":"https:\/\/iright.com\/products\/proteintech-25517-1-ap","provider":"Iright","version":"1.0","type":"link"}