{"product_id":"proteintech-25544-1-ap","title":"Proteintech, 25544-1-AP, SCML2 Polyclonal antibody","description":"Size: 20ul \/ 150ul\nThe SCML2 (25544-1-AP) by Proteintech is a Polyclonal antibody targeting SCML2 in WB, IF\/ICC, IP, ELISA applications with reactivity to human,  mouse samples\n25544-1-AP targets SCML2 in WB, IF\/ICC, IP, ELISA applications and shows reactivity with human,  mouse samples.\n\u003cb\u003eTested Applications\u003c\/b\u003e\nPositive WB detected in: HEK-293 cells, mouse testis tissue,  K-562 cells\nPositive IP detected in: HEK-293 cells\nPositive IF\/ICC detected in: HEK-293 cells\n\u003cb\u003eRecommended dilution\u003c\/b\u003e\nWestern Blot (WB): WB : 1:500-1:1000\nImmunoprecipitation (IP): IP : 0.5-4.0 ug for 1.0-3.0 mg of total protein lysate\nImmunofluorescence (IF)\/ICC: IF\/ICC : 1:20-1:200\n\u003cb\u003eBackground Information\u003c\/b\u003e\nThe human SCML2 gene, a mammalian homologue of the Drosophila PcG protein SCM, encodes two protein isoforms: SCML2A that is bound to chromatin and SCML2B that is predominantly nucleoplasmic (PMID: 24358021). Polycomb repressive complex-1 (PRC1) is essential for the epigenetic regulation of gene expression. SCML2 is a Polycomb-group protein that associates with PRC1. SCML2 participates in the epigenetic control of transcription directly and in cooperation with PRC1 (PMID: 24986859).\n\u003cb\u003eSpecification\u003c\/b\u003e\nTested Reactivity: human, mouse\nHost \/ Isotype: Rabbit \/ IgG\nClass: Polyclonal\nType: Antibody\nImmunogen: CatNo: Ag22271 Product name: Recombinant human SCML2 protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 563-649 aa of BC064617 Sequence: MYIHTSVSQDFSRSVPGTTSSPLVGDISPKSSPHEVKFQMQRKSEAPSYIAVPDPSVLKQGFSKDPSTWSVDEVIQFMKHTDPQISG Predict reactive species\nFull Name: sex comb on midleg-like 2 (Drosophila)\nCalculated Molecular Weight: 700 aa, 77 kDa\nObserved Molecular Weight: 70 kDa, 80 kDa\nGenBank Accession Number: BC064617\nGene Symbol: SCML2\nGene ID (NCBI): 10389\nRRID: AB_2880127\nConjugate: Unconjugated\nForm: Liquid\nPurification Method: Antigen affinity purification\nUNIPROT ID: Q9UQR0\nStorage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.\nStorage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.","brand":"Proteintech","offers":[{"title":"Default Title","offer_id":46887793852585,"sku":"25544-1-AP","price":0.99,"currency_code":"USD","in_stock":true}],"url":"https:\/\/iright.com\/products\/proteintech-25544-1-ap","provider":"Iright","version":"1.0","type":"link"}