{"product_id":"proteintech-25573-1-ap","title":"Proteintech, 25573-1-AP, ZNF689 Polyclonal antibody","description":"Size: 20ul \/ 150ul\nThe ZNF689 (25573-1-AP) by Proteintech is a Polyclonal antibody targeting ZNF689 in WB, ELISA applications with reactivity to human, mouse, rat samples\n25573-1-AP targets ZNF689 in WB, ELISA applications and shows reactivity with human, mouse, rat samples.\n\u003cb\u003eTested Applications\u003c\/b\u003e\nPositive WB detected in: HeLa cells, HepG2 cells,  mouse testis tissue,  human testis tissue,  mouse tests tissue,  rat testis tissue\n\u003cb\u003eRecommended dilution\u003c\/b\u003e\nWestern Blot (WB): WB : 1:1000-1:6000\n\u003cb\u003eBackground Information\u003c\/b\u003e\nZNF689, a C2H2-type of Krüppel-associated box (KRAB)-zinc finger protein, is a putative transcription regulating factor. ZNF689 knockdown induced expression of the pro-apoptotic factors of the Bcl-2 family, Bax, Bcl-2 antagonist\/killer 1 and Bid, resulting in tumor cell apoptosis (PMID: 21624362). ZNF689 was identified to be involved in suppressing the apoptosis of HCC cells via downregulation of the expression of pro-apoptotic factors (PMID: 38168642).\n\u003cb\u003eSpecification\u003c\/b\u003e\nTested Reactivity: human, mouse, rat\nHost \/ Isotype: Rabbit \/ IgG\nClass: Polyclonal\nType: Antibody\nImmunogen: CatNo: Ag22252 Product name: Recombinant human ZNF689 protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 77-173 aa of BC014000 Sequence: LISWLERNTDDWEPAALDPQEYPRGLTVQRKSRTRKKNGEKEVFPPKEAPRKGKRGRRPSKPRLIPRQTSGGPICPDCGCTFPDHQALESHKCAQNL Predict reactive species\nFull Name: zinc finger protein 689\nCalculated Molecular Weight: 500 aa, 57 kDa\nObserved Molecular Weight: 50-57 kDa\nGenBank Accession Number: BC014000\nGene Symbol: ZNF689\nGene ID (NCBI): 115509\nRRID: AB_2880134\nConjugate: Unconjugated\nForm: Liquid\nPurification Method: Antigen affinity purification\nUNIPROT ID: Q96CS4\nStorage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.\nStorage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.","brand":"Proteintech","offers":[{"title":"Default Title","offer_id":46887952613545,"sku":"25573-1-AP","price":0.99,"currency_code":"USD","in_stock":true}],"url":"https:\/\/iright.com\/products\/proteintech-25573-1-ap","provider":"Iright","version":"1.0","type":"link"}