{"product_id":"proteintech-25577-1-ap","title":"Proteintech, 25577-1-AP, KBTBD10 Polyclonal antibody","description":"Size: 20ul \/ 150ul\nThe KBTBD10 (25577-1-AP) by Proteintech is a Polyclonal antibody targeting KBTBD10 in WB, IHC, ELISA applications with reactivity to human,  mouse samples\n25577-1-AP targets KBTBD10 in WB, IHC, ELISA applications and shows reactivity with human,  mouse samples.\n\u003cb\u003eTested Applications\u003c\/b\u003e\nPositive WB detected in: mouse heart tissue, mouse skeletal muscle tissue\nPositive IHC detected in: human heart tissue,  human skeletal muscle tissueNote: suggested antigen retrieval withTE buffer pH 9.0;(*) Alternatively, antigen retrieval may be performed withcitrate buffer pH 6.0\n\u003cb\u003eRecommended dilution\u003c\/b\u003e\nWestern Blot (WB): WB : 1:1000-1:6000\nImmunohistochemistry (IHC): IHC : 1:20-1:200\n\u003cb\u003eBackground Information\u003c\/b\u003e\nKBTBD10, also named as KBTBD10 or KRP1, is a 606 amino acid protein, which contains one BACK (BTB\/Kelch associated) domain, one BTB (POZ) domain and five Kelch repeats. KBTBD10 localizes in the cytoplasm and is expressed in Sarcomeric muscle. KBTBD10 is involved in skeletal muscle development and differentiation. KBTBD10 regulates proliferation and differentiation of myoblasts and plays a role in myofibril assembly by promoting lateral fusion of adjacent thin fibrils into mature, wide myofibrils.\n\u003cb\u003eSpecification\u003c\/b\u003e\nTested Reactivity: human, mouse\nHost \/ Isotype: Rabbit \/ IgG\nClass: Polyclonal\nType: Antibody\nImmunogen: CatNo: Ag22311 Product name: Recombinant human KBTBD10 protein Source: e coli. -derived, PET30a Tag: 6*His Domain: 205-382 aa of BC006534 Sequence: RTDKENRVKNLSEVFDCIRFRLMTEKYFKDHVEKDDIIKSNPDLQKKIKVLKDAFAGKLPEPSKNAAKTGAGEVNGDVGDEDLLPGYLNDIPRHGMFVKDLILLVNDTAAVAYDPTENECYLTALAEQIPRNHSSIVTQQNQIYVVGGLYVDEENKDQPLQSYFFQLDSIASEWVGLP Predict reactive species\nFull Name: kelch repeat and BTB (POZ) domain containing 10\nCalculated Molecular Weight: 606 aa, 68 kDa\nObserved Molecular Weight: 68 kDa\nGenBank Accession Number: BC006534\nGene Symbol: KBTBD10\nGene ID (NCBI): 10324\nRRID: AB_2880137\nConjugate: Unconjugated\nForm: Liquid\nPurification Method: Antigen affinity purification\nUNIPROT ID: O60662\nStorage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.\nStorage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.","brand":"Proteintech","offers":[{"title":"Default Title","offer_id":46887690272937,"sku":"25577-1-AP","price":0.99,"currency_code":"USD","in_stock":true}],"url":"https:\/\/iright.com\/products\/proteintech-25577-1-ap","provider":"Iright","version":"1.0","type":"link"}