{"product_id":"proteintech-25604-1-ap","title":"Proteintech, 25604-1-AP, Znt5 Polyclonal antibody","description":"Size: 20ul \/ 150ul\nThe Znt5 (25604-1-AP) by Proteintech is a Polyclonal antibody targeting Znt5 in IHC, IP, ELISA applications with reactivity to human, mouse samples\n25604-1-AP targets Znt5 in WB, IHC, IP, ELISA applications and shows reactivity with human, mouse samples.\n\u003cb\u003eTested Applications\u003c\/b\u003e\nPositive IP detected in: mouse liver tissue\nPositive IHC detected in: human intrahepatic cholangiocarcinoma tissueNote: suggested antigen retrieval withTE buffer pH 9.0;(*) Alternatively, antigen retrieval may be performed withcitrate buffer pH 6.0\n\u003cb\u003eRecommended dilution\u003c\/b\u003e\nImmunoprecipitation (IP): IP : 0.5-4.0 ug for 1.0-3.0 mg of total protein lysate\nImmunohistochemistry (IHC): IHC : 1:50-1:500\n\u003cb\u003eSpecification\u003c\/b\u003e\nTested Reactivity: human, mouse\nCited Reactivity: human, chicken\nHost \/ Isotype: Rabbit \/ IgG\nClass: Polyclonal\nType: Antibody\nImmunogen: CatNo: Ag12947 Product name: Recombinant human SLC30A5 protein Source: e coli. -derived, PET28a Tag: 6*His Domain: 1-118 aa of BC000808 Sequence: MEEKYGGDVLAGPGGGGGLGPVDVPSARLTKYIVLLCFTKFLKAVGLFESYDLLKAVHIVQFIFILKLGTAFFMVLFQKPFSSGKTITKHQIIGSLKIPGRKEFKDKKLNDPRKLVGN Predict reactive species\nFull Name: solute carrier family 30 (zinc transporter), member 5\nCalculated Molecular Weight: 84 kDa\nObserved Molecular Weight: 84-87 kDa\nGenBank Accession Number: BC000808\nGene Symbol: Znt5\nGene ID (NCBI): 64924\nRRID: AB_2880155\nConjugate: Unconjugated\nForm: Liquid\nPurification Method: Antigen affinity purification\nUNIPROT ID: Q8TAD4\nStorage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.\nStorage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.","brand":"Proteintech","offers":[{"title":"Default Title","offer_id":46869391114409,"sku":"25604-1-AP","price":0.99,"currency_code":"USD","in_stock":true}],"url":"https:\/\/iright.com\/products\/proteintech-25604-1-ap","provider":"Iright","version":"1.0","type":"link"}