{"product_id":"proteintech-25614-1-ap","title":"Proteintech, 25614-1-AP, P27; KIP1 Polyclonal antibody","description":"Size: 20ul \/ 150ul\nThe P27; KIP1 (25614-1-AP) by Proteintech is a Polyclonal antibody targeting P27; KIP1 in WB, IHC, IF\/ICC, IF-P, FC (Intra), IP, ELISA applications with reactivity to human, mouse samples\n25614-1-AP targets P27; KIP1 in WB, IHC, IF\/ICC, IF-P, FC (Intra), IP, CoIP, ELISA applications and shows reactivity with human, mouse samples.\n\u003cb\u003eTested Applications\u003c\/b\u003e\nPositive WB detected in: HeLa cells, NIH\/3T3 cells,  HepG2 cells,  MCF-7 cells,  Jurkat cells\nPositive IP detected in: NIH\/3T3 cells\nPositive IHC detected in: human breast cancer tissue, human lung cancer tissue,  human colon cancer tissue,  human ovary tumor tissueNote: suggested antigen retrieval withTE buffer pH 9.0;(*) Alternatively, antigen retrieval may be performed withcitrate buffer pH 6.0\nPositive IF-P detected in: mouse testis tissue\nPositive IF\/ICC detected in: HepG2 cells\nPositive FC (Intra) detected in: MCF-7 cells\n\u003cb\u003eRecommended dilution\u003c\/b\u003e\nWestern Blot (WB): WB : 1:1000-1:8000\nImmunoprecipitation (IP): IP : 0.5-4.0 ug for 1.0-3.0 mg of total protein lysate\nImmunohistochemistry (IHC): IHC : 1:50-1:500\nImmunofluorescence (IF)-P: IF-P : 1:200-1:800\nImmunofluorescence (IF)\/ICC: IF\/ICC : 1:50-1:500\nFlow Cytometry (FC) (INTRA): FC (INTRA) : 0.40 ug per 10^6 cells in a 100 µl suspension\n\u003cb\u003eBackground Information\u003c\/b\u003e\nCDKN1B, also named as P27 or KIP1, is a cyclin-dependent kinase inhibitor, which shares a limited similarity with CDK inhibitor CDKN1A\/p21. P27 binds to and prevents the activation of cyclin E-CDK2 or cyclin D-CDK4 complexes, and thus controlling cell cycle progression at G1. The degradation of this protein, which is triggered by its CDK dependent phosphorylation and subsequent ubiquitination by SCF complexes, is required for the cellular transition from quiescence to the proliferative state. Downregulation of P27 has been implicated in the progression of several malignancies, including lung cancer, hepatocellular carcinoma, salivary cancer, oral squamous cell carcinomas, and gastric cancer.\n\u003cb\u003eSpecification\u003c\/b\u003e\nTested Reactivity: human, mouse\nCited Reactivity: human, mouse, rat, canine, bovine, sheep\nHost \/ Isotype: Rabbit \/ IgG\nClass: Polyclonal\nType: Antibody\nImmunogen: CatNo: Ag22582 Product name: Recombinant human P27; KIP1 protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 44-198 aa of BC001971 Sequence: DLEKHCRDMEEASQRKWNFDFQNHKPLEGKYEWQEVEKGSLPEFYYRPPRPPKGACKVPAQESQDGSGSRPAAPLIGAPANSEDTHLVDPKTDPSDSQTGLAEQCAGIRKRPATDDSSTQNKRANRTEENVSDGSPNAGSVEQTPKKPGLRRRQT Predict reactive species\nFull Name: cyclin-dependent kinase inhibitor 1B (p27, Kip1)\nCalculated Molecular Weight: 198 aa, 22 kDa\nObserved Molecular Weight: 27 kDa\nGenBank Accession Number: BC001971\nGene Symbol: p27 Kip1\/CDKN1B\nGene ID (NCBI): 1027\nRRID: AB_2880161\nConjugate: Unconjugated\nForm: Liquid\nPurification Method: Antigen affinity purification\nUNIPROT ID: P46527\nStorage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.\nStorage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.","brand":"Proteintech","offers":[{"title":"Default Title","offer_id":46868822491305,"sku":"25614-1-AP","price":0.99,"currency_code":"USD","in_stock":true}],"url":"https:\/\/iright.com\/products\/proteintech-25614-1-ap","provider":"Iright","version":"1.0","type":"link"}