{"product_id":"proteintech-25615-1-ap","title":"Proteintech, 25615-1-AP, MBOAT1 Polyclonal antibody","description":"Size: 20ul \/ 150ul\nThe MBOAT1 (25615-1-AP) by Proteintech is a Polyclonal antibody targeting MBOAT1 in WB, ELISA applications with reactivity to human samples\n25615-1-AP targets MBOAT1 in WB, ELISA applications and shows reactivity with human samples.\n\u003cb\u003eTested Applications\u003c\/b\u003e\nPositive WB detected in: MCF-7 cells\n\u003cb\u003eRecommended dilution\u003c\/b\u003e\nWestern Blot (WB): WB : 1:500-1:2000\n\u003cb\u003eBackground Information\u003c\/b\u003e\nMBOAT1 (membrane bound O-acyltransferase domain containing 1), also known as LPLAT or LPSAT. It is expected to be located in membrane and widely expressed in colon, small intestine. MBOAT1 belongs to the membrane-bound O- acetyltransferase superfamily. Its encoded transmembrane protein is an enzyme that transfers organic compounds, preferably oleoyl-CoA, to the hydroxyl group of protein target in the membrane. The translocation that destroys the gene may be related to short finger toe syndrome. At the same time, it may also play a role in neurite growth during neuronal differentiation (PMID: 18772128). Studies have determined that phospholipid modifying enzymes MBOAT1 and MBOAT2 are iron sag inhibitors. MBOAT1\/2 can inhibit iron sag by reshaping the phospholipid profile of cells, and their iron sag monitoring function is independent of GPX4 or FSP1. MBOAT1 and MBOAT2 are up-regulated by sex hormone receptors, namely estrogen receptor (ER) and androgen receptor (AR), respectively (PMID: 37267948). The calculated molecular weight of MBOAT1 is 57 kDa. This antibody can recognize the 40 kDa isoform of MBOAT1.\n\u003cb\u003eSpecification\u003c\/b\u003e\nTested Reactivity: human\nHost \/ Isotype: Rabbit \/ IgG\nClass: Polyclonal\nType: Antibody\nImmunogen: CatNo: Ag22470 Product name: Recombinant human MBOAT1 protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 192-286 aa of BC150652 Sequence: FMSVIAGPCNNFKDYIAFIEGKHIHMKLLEVNWKRKGFHSLPEPSPTGAVIHKLGITLVSLLLFLTLTKTFPVTCLVDDWFVHKASFPARLCYLY Predict reactive species\nFull Name: membrane bound O-acyltransferase domain containing 1\nCalculated Molecular Weight: 495 aa, 57 kDa\nObserved Molecular Weight: 45-57 kDa\nGenBank Accession Number: BC150652\nGene Symbol: MBOAT1\nGene ID (NCBI): 154141\nRRID: AB_3085808\nConjugate: Unconjugated\nForm: Liquid\nPurification Method: Antigen affinity purification\nUNIPROT ID: Q6ZNC8\nStorage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.\nStorage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.","brand":"Proteintech","offers":[{"title":"Default Title","offer_id":46887714488489,"sku":"25615-1-AP","price":0.99,"currency_code":"USD","in_stock":true}],"url":"https:\/\/iright.com\/products\/proteintech-25615-1-ap","provider":"Iright","version":"1.0","type":"link"}