{"product_id":"proteintech-25616-1-ap","title":"Proteintech, 25616-1-AP, ASB13 Polyclonal antibody","description":"Size: 20ul \/ 150ul\nThe ASB13 (25616-1-AP) by Proteintech is a Polyclonal antibody targeting ASB13 in WB, IHC, IF\/ICC, ELISA applications with reactivity to human, mouse, rat samples\n25616-1-AP targets ASB13 in WB, IHC, IF\/ICC, ELISA applications and shows reactivity with human, mouse, rat samples.\n\u003cb\u003eTested Applications\u003c\/b\u003e\nPositive WB detected in: L02 cells, mouse heart tissue,  mouse liver tissue,  rat heart tissue,  rat liver tissue\nPositive IHC detected in: human small intestine tissue, human colon tissueNote: suggested antigen retrieval withTE buffer pH 9.0;(*) Alternatively, antigen retrieval may be performed withcitrate buffer pH 6.0\nPositive IF\/ICC detected in: HepG2 cells\n\u003cb\u003eRecommended dilution\u003c\/b\u003e\nWestern Blot (WB): WB : 1:500-1:1000\nImmunohistochemistry (IHC): IHC : 1:50-1:500\nImmunofluorescence (IF)\/ICC: IF\/ICC : 1:50-1:500\n\u003cb\u003eSpecification\u003c\/b\u003e\nTested Reactivity: human, mouse, rat\nHost \/ Isotype: Rabbit \/ IgG\nClass: Polyclonal\nType: Antibody\nImmunogen: CatNo: Ag22533 Product name: Recombinant human ASB13 protein Source: e coli. -derived, PET30a Tag: 6*His Domain: 5-173 aa of BC012056 Sequence: AADGCFLGDVGFWVERTPVHEAAQRGESLQLQQLIESGACVNQVTVDSITPLHAASLQGQARCVQLLLAAGAQVDARNIDGSTPLCDACASGSIECVKLLLSYGAKVNPPLYTASPLHEACMSGSSECVRLLIDVGANLEAHDCHFGTPLHVACAREHLDCVKVLLNAA Predict reactive species\nFull Name: ankyrin repeat and SOCS box-containing 13\nCalculated Molecular Weight: 278 aa, 30 kDa\nObserved Molecular Weight: 30 kDa\nGenBank Accession Number: BC012056\nGene Symbol: ASB13\nGene ID (NCBI): 79754\nRRID: AB_2880162\nConjugate: Unconjugated\nForm: Liquid\nPurification Method: Antigen affinity purification\nUNIPROT ID: Q8WXK3\nStorage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.\nStorage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.","brand":"Proteintech","offers":[{"title":"Default Title","offer_id":46885072044201,"sku":"25616-1-AP","price":0.99,"currency_code":"USD","in_stock":true}],"url":"https:\/\/iright.com\/products\/proteintech-25616-1-ap","provider":"Iright","version":"1.0","type":"link"}