{"product_id":"proteintech-25630-1-ap","title":"Proteintech, 25630-1-AP, C9orf61 Polyclonal antibody","description":"Size: 20ul \/ 150ul\nThe C9orf61 (25630-1-AP) by Proteintech is a Polyclonal antibody targeting C9orf61 in WB, IHC, ELISA applications with reactivity to human, mouse samples\n25630-1-AP targets C9orf61 in WB, IHC, CoIP, ELISA applications and shows reactivity with human, mouse samples.\n\u003cb\u003eTested Applications\u003c\/b\u003e\nPositive WB detected in: mouse skeletal muscle tissue\nPositive IHC detected in: human heart tissue,  human skeletal muscle tissueNote: suggested antigen retrieval withTE buffer pH 9.0;(*) Alternatively, antigen retrieval may be performed withcitrate buffer pH 6.0\n\u003cb\u003eRecommended dilution\u003c\/b\u003e\nWestern Blot (WB): WB : 1:500-1:1000\nImmunohistochemistry (IHC): IHC : 1:20-1:200\n\u003cb\u003eBackground Information\u003c\/b\u003e\nC9orf61, also named as FAM189A2 and X123, is promoinently expressed in muscle. It has three isoforms with MW 45-50 kDa, 32-35 kDa and 27 kDa.\n\u003cb\u003eSpecification\u003c\/b\u003e\nTested Reactivity: human, mouse\nCited Reactivity: human\nHost \/ Isotype: Rabbit \/ IgG\nClass: Polyclonal\nType: Antibody\nImmunogen: CatNo: Ag22242 Product name: Recombinant human C9orf61 protein Source: e coli. -derived, PET30a Tag: 6*His Domain: 288-450 aa of BC113685 Sequence: PVLSCEAATQTERRLDLAAVTLRRGLRSRASRCRPRSLIDYKSYMDTKLLVARFLEQSSCTMTPDIHELVENIKSVLKSDEEHMEEAITSASFLEQIMAPLQPSTSRAHKLPSRRQPGLLHLQSCGDLHTFTPAGRPRAERRPRRVEAERPHSLIGVIRETVL Predict reactive species\nFull Name: chromosome 9 open reading frame 61\nCalculated Molecular Weight: 450 aa, 50 kDa\nObserved Molecular Weight: 45-50 kDa\nGenBank Accession Number: BC113685\nGene Symbol: C9orf61\nGene ID (NCBI): 9413\nRRID: AB_2880170\nConjugate: Unconjugated\nForm: Liquid\nPurification Method: Antigen affinity purification\nUNIPROT ID: Q15884\nStorage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.\nStorage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.","brand":"Proteintech","offers":[{"title":"Default Title","offer_id":46869647949993,"sku":"25630-1-AP","price":0.99,"currency_code":"USD","in_stock":true}],"url":"https:\/\/iright.com\/products\/proteintech-25630-1-ap","provider":"Iright","version":"1.0","type":"link"}