{"product_id":"proteintech-25682-1-ap","title":"Proteintech, 25682-1-AP, CD63 Polyclonal antibody","description":"Size: 20ul \/ 150ul\nThe CD63 (25682-1-AP) by Proteintech is a Polyclonal antibody targeting CD63 in WB, IHC, IF\/ICC, IF-P, ELISA applications with reactivity to human samples\n25682-1-AP targets CD63 in WB, IHC, IF\/ICC, IF-P, IP, ChIP, ELISA applications and shows reactivity with human samples.\n\u003cb\u003eTested Applications\u003c\/b\u003e\nPositive WB detected in: human urine exosomes tissue, A375 cells,  human serum exosomes,  THP-1 cells,  human peripheral blood platelets\nPositive IHC detected in: human malignant melanoma tissue, human lymphoma tissue,  human tonsillitis tissueNote: suggested antigen retrieval withTE buffer pH 9.0;(*) Alternatively, antigen retrieval may be performed withcitrate buffer pH 6.0\nPositive IF-P detected in: human malignant melanoma tissue\nPositive IF\/ICC detected in: A431 cells\n\u003cb\u003eRecommended dilution\u003c\/b\u003e\nWestern Blot (WB): WB : 1:500-1:40000\nImmunohistochemistry (IHC): IHC : 1:400-1:1600\nImmunofluorescence (IF)-P: IF-P : 1:50-1:500\nImmunofluorescence (IF)\/ICC: IF\/ICC : 1:200-1:800\n\u003cb\u003eBackground Information\u003c\/b\u003e\nCD63 is a 30-60 kDa lysosomal membrane protein that belongs to the tetraspanin family. This protein plays many important roles in immuno-physiological functions. It mediates signal transduction events that play a role in the regulation of cell development, activation, growth, and motility. CD63 is expressed on activated platelets, thus it may function as a blood platelet activation marker. CD63 is a lysosomal membrane glycoprotein that is translocated to plasma membrane after platelet activation. The CD63 tetraspanin is highly expressed in the early stages of melanoma and decreases in advanced lesions, suggesting it as a possible suppressor of tumor progression. Deficiency of this protein is associated with Hermansky-Pudlak syndrome.\n\u003cb\u003eSpecification\u003c\/b\u003e\nTested Reactivity: human\nCited Reactivity: human, pig, rabbit, monkey, hamster, goat\nHost \/ Isotype: Rabbit \/ IgG\nClass: Polyclonal\nType: Antibody\nImmunogen: CatNo: Ag19690 Product name: Recombinant human CD63 protein Source: e coli. -derived, PET28a Tag: 6*His Domain: 104-209 aa of BC002349 Sequence: GYVFRDKVMSEFNNNFRQQMENYPKNNHTASILDRMQADFKCCGAANYTDWEKIPSMSKNRVPDSCCINVTVGCGINFNEKAIHKEGCVEKIGGWLRKNVLVVAAA Predict reactive species\nFull Name: CD63 molecule\nCalculated Molecular Weight: 26 kDa\nObserved Molecular Weight: 30-60 kDa\nGenBank Accession Number: BC002349\nGene Symbol: CD63\nGene ID (NCBI): 967\nRRID: AB_2783831\nConjugate: Unconjugated\nForm: Liquid\nPurification Method: Antigen affinity purification\nUNIPROT ID: P08962\nStorage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.\nStorage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.","brand":"Proteintech","offers":[{"title":"Default Title","offer_id":46868815675561,"sku":"25682-1-AP","price":0.99,"currency_code":"USD","in_stock":true}],"url":"https:\/\/iright.com\/products\/proteintech-25682-1-ap","provider":"Iright","version":"1.0","type":"link"}