{"product_id":"proteintech-25693-1-ap","title":"Proteintech, 25693-1-AP, ATAD4 \/ PRR15L Polyclonal antibody","description":"Size: 20ul \/ 150ul\nThe ATAD4 \/ PRR15L (25693-1-AP) by Proteintech is a Polyclonal antibody targeting ATAD4 \/ PRR15L in IHC, IF\/ICC, ELISA applications with reactivity to human, mouse samples\n25693-1-AP targets ATAD4 \/ PRR15L in IHC, IF\/ICC, ELISA applications and shows reactivity with human, mouse samples.\n\u003cb\u003eTested Applications\u003c\/b\u003e\nPositive IHC detected in: mouse kidney tissueNote: suggested antigen retrieval withTE buffer pH 9.0;(*) Alternatively, antigen retrieval may be performed withcitrate buffer pH 6.0\nPositive IF\/ICC detected in: A431 cells\n\u003cb\u003eRecommended dilution\u003c\/b\u003e\nImmunohistochemistry (IHC): IHC : 1:50-1:500\nImmunofluorescence (IF)\/ICC: IF\/ICC : 1:50-1:500\n\u003cb\u003eBackground Information\u003c\/b\u003e\nATAD4 (ATPase family AAA domain-containing protein 4), also known as PRR15L (Proline Rich 15 Like),  and its function has not yet been discovered.\n\u003cb\u003eSpecification\u003c\/b\u003e\nTested Reactivity: human, mouse\nHost \/ Isotype: Rabbit \/ IgG\nClass: Polyclonal\nType: Antibody\nImmunogen: CatNo: Ag22500 Product name: Recombinant human ATAD4 protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 1-71 aa of BC002865 Sequence: MTTEIGWWKLTFLRKKKSTPKVLYEIPDTYAQTEGDAEPPRPDAGGPNSDFNTRLEKIVDKSTKGKHVKVS Predict reactive species\nFull Name: ATPase family, AAA domain containing 4\nCalculated Molecular Weight: 103 aa, 12 kDa\nGenBank Accession Number: BC002865\nGene Symbol: ATAD4\nGene ID (NCBI): 79170\nRRID: AB_3085816\nConjugate: Unconjugated\nForm: Liquid\nPurification Method: Antigen affinity purification\nUNIPROT ID: Q9BU68\nStorage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.\nStorage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.","brand":"Proteintech","offers":[{"title":"Default Title","offer_id":46885092688041,"sku":"25693-1-AP","price":0.99,"currency_code":"USD","in_stock":true}],"url":"https:\/\/iright.com\/products\/proteintech-25693-1-ap","provider":"Iright","version":"1.0","type":"link"}