{"product_id":"proteintech-25703-1-ap","title":"Proteintech, 25703-1-AP, GDPD5 Polyclonal antibody","description":"Size: 20ul \/ 150ul\nThe GDPD5 (25703-1-AP) by Proteintech is a Polyclonal antibody targeting GDPD5 in WB, IHC, ELISA applications with reactivity to human samples\n25703-1-AP targets GDPD5 in WB, IHC, CoIP, ELISA applications and shows reactivity with human samples.\n\u003cb\u003eTested Applications\u003c\/b\u003e\nPositive WB detected in: K-562 cells,  COLO 320 cells\nPositive IHC detected in: human placenta tissueNote: suggested antigen retrieval withTE buffer pH 9.0;(*) Alternatively, antigen retrieval may be performed withcitrate buffer pH 6.0\n\u003cb\u003eRecommended dilution\u003c\/b\u003e\nWestern Blot (WB): WB : 1:200-1:1000\nImmunohistochemistry (IHC): IHC : 1:500-1:2000\n\u003cb\u003eBackground Information\u003c\/b\u003e\nGDPD5(Glycerophosphodiester phosphodiesterase domain-containing protein 5) is also named as GDE2 and belongs to the glycerophosphoryl diester phosphodiesterase family. The deduced sequence of GDE2 contains 607 amino acids with seven putative transmembrane regions. GDPD5 is a glycerophosphocholine phosphodiesterase that osmotically regulates the osmoprotective organic osmolyte GPC(PMID:18667693). It has  5 isoforms produced by alternative splicing.\n\u003cb\u003eSpecification\u003c\/b\u003e\nTested Reactivity: human\nCited Reactivity: human\nHost \/ Isotype: Rabbit \/ IgG\nClass: Polyclonal\nType: Antibody\nImmunogen: CatNo: Ag22530 Product name: Recombinant human GDPD5 protein Source: e coli. -derived, PET30a Tag: 6*His Domain: 474-605 aa of BC018771 Sequence: TSDNSHTLSQVPSPLWIMPPDEYCLMWVTADLVSFTLIVGIFVLQKWRLGGIRSYNPEQIMLSAAVRRTSRDVSIMKEKLIFSEISDGVEVSDVLSVCSDNSYDTYANSTATPVGPRGGGSHTKTLIERSGR Predict reactive species\nFull Name: glycerophosphodiester phosphodiesterase domain containing 5\nCalculated Molecular Weight: 605 aa, 69 kDa\nObserved Molecular Weight: 51 kDa\nGenBank Accession Number: BC018771\nGene Symbol: GDPD5\nGene ID (NCBI): 81544\nRRID: AB_2880200\nConjugate: Unconjugated\nForm: Liquid\nPurification Method: Antigen affinity purification\nUNIPROT ID: Q8WTR4\nStorage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.\nStorage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.","brand":"Proteintech","offers":[{"title":"Default Title","offer_id":46869544435881,"sku":"25703-1-AP","price":0.99,"currency_code":"USD","in_stock":true}],"url":"https:\/\/iright.com\/products\/proteintech-25703-1-ap","provider":"Iright","version":"1.0","type":"link"}