{"product_id":"proteintech-25727-1-ap","title":"Proteintech, 25727-1-AP, ATP1A3 Polyclonal antibody","description":"Size: 20ul \/ 150ul\nThe ATP1A3 (25727-1-AP) by Proteintech is a Polyclonal antibody targeting ATP1A3 in WB, IHC, IF-P, IP, ELISA applications with reactivity to human,  mouse, rat samples\n25727-1-AP targets ATP1A3 in WB, IHC, IF-P, IP, ELISA applications and shows reactivity with human,  mouse, rat samples.\n\u003cb\u003eTested Applications\u003c\/b\u003e\nPositive WB detected in: mouse brain tissue\nPositive IP detected in: rat brain tissue\nPositive IHC detected in: human prostate cancer tissueNote: suggested antigen retrieval withTE buffer pH 9.0;(*) Alternatively, antigen retrieval may be performed withcitrate buffer pH 6.0\nPositive IF-P detected in: mouse brain tissue\n\u003cb\u003eRecommended dilution\u003c\/b\u003e\nWestern Blot (WB): WB : 1:2000-1:16000\nImmunoprecipitation (IP): IP : 0.5-4.0 ug for 1.0-3.0 mg of total protein lysate\nImmunohistochemistry (IHC): IHC : 1:50-1:500\nImmunofluorescence (IF)-P: IF-P : 1:50-1:500\n\u003cb\u003eBackground Information\u003c\/b\u003e\nATP1A3 participates in the catalyticing hydrolysis of ATP and the exchanging of sodium and potassium ions across plasma membrane. The catalyticing activity mode is ATP + H2O + Na+(In) + K+(Out) = ADP + phosphate + Na+(Out) + K+(In). It has been published that the neurologic disorders rapid-onset dystonia-parkionsonism (RDP), alternating hemiplegia of childhood (ACH) and CAPOS syndrome (cerebellar ataxia, areflexia, pes cavus, optic atrophy and sensorineural hearing loss) are all related with the mutation of ATP1A3. There are other reports suggest that early life epilepsy and episodic apnea revealing are potentially associated with the mutation of ATP1A3 as a result of impairment of Na\/K homeostasis. This antibody is generated against the C-terminal region (665-1013aa) of ATP1A3 and detects the band around 100-113 kDa in SDS-PAGE.(PMID: 30097153, 20301294, 29922587)\n\u003cb\u003eSpecification\u003c\/b\u003e\nTested Reactivity: human, mouse, rat\nCited Reactivity: mouse\nHost \/ Isotype: Rabbit \/ IgG\nClass: Polyclonal\nType: Antibody\nImmunogen: CatNo: Ag22842 Product name: Recombinant human ATP1A3 protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 1-65 aa of BC015566 Sequence: MGDKKDDKDSPKKNKGKERRDLDDLKKEVAMTEHKMSVEEVCRKYNTDCVQGLTHSKAQEILARD Predict reactive species\nFull Name: ATPase, Na+\/K+ transporting, alpha 3 polypeptide\nCalculated Molecular Weight: 1013 aa, 112 kDa\nObserved Molecular Weight: 110-113 kDa\nGenBank Accession Number: BC015566\nGene Symbol: ATP1A3\nGene ID (NCBI): 478\nRRID: AB_3085820\nConjugate: Unconjugated\nForm: Liquid\nPurification Method: Antigen affinity purification\nUNIPROT ID: P13637\nStorage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.\nStorage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.","brand":"Proteintech","offers":[{"title":"Default Title","offer_id":46869517041833,"sku":"25727-1-AP","price":0.99,"currency_code":"USD","in_stock":true}],"url":"https:\/\/iright.com\/products\/proteintech-25727-1-ap","provider":"Iright","version":"1.0","type":"link"}