{"product_id":"proteintech-25732-1-ap","title":"Proteintech, 25732-1-AP, LPPR2 Polyclonal antibody","description":"Size: 20ul \/ 150ul\nThe LPPR2 (25732-1-AP) by Proteintech is a Polyclonal antibody targeting LPPR2 in WB, IHC, ELISA applications with reactivity to human, mouse samples\n25732-1-AP targets LPPR2 in WB, IHC, ELISA applications and shows reactivity with human, mouse samples.\n\u003cb\u003eTested Applications\u003c\/b\u003e\nPositive WB detected in: 3T3-L1 cells,  HeLa cells\nPositive IHC detected in: human kidney tissue, human liver cancer tissue,  human skeletal muscle tissueNote: suggested antigen retrieval withTE buffer pH 9.0;(*) Alternatively, antigen retrieval may be performed withcitrate buffer pH 6.0\n\u003cb\u003eRecommended dilution\u003c\/b\u003e\nWestern Blot (WB): WB : 1:500-1:2000\nImmunohistochemistry (IHC): IHC : 1:1000-1:4000\n\u003cb\u003eSpecification\u003c\/b\u003e\nTested Reactivity: human, mouse\nCited Reactivity: human\nHost \/ Isotype: Rabbit \/ IgG\nClass: Polyclonal\nType: Antibody\nImmunogen: CatNo: Ag22839 Product name: Recombinant human LPPR2 protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 272-343 aa of BC009378 Sequence: TGAAIATFLVTCVVHNFQSRPPSGRRLSPWEDLGQAPTMDSPLEKNPRSAGRIRHRHGSPHPSRRTAPAVAT Predict reactive species\nFull Name: lipid phosphate phosphatase-related protein type 2\nCalculated Molecular Weight: 427 aa, 46 kDa\nObserved Molecular Weight: 37 kDa\nGenBank Accession Number: BC009378\nGene Symbol: LPPR2\nGene ID (NCBI): 64748\nRRID: AB_2880215\nConjugate: Unconjugated\nForm: Liquid\nPurification Method: Antigen affinity purification\nUNIPROT ID: Q96GM1\nStorage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.\nStorage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.","brand":"Proteintech","offers":[{"title":"Default Title","offer_id":46869704179881,"sku":"25732-1-AP","price":0.99,"currency_code":"USD","in_stock":true}],"url":"https:\/\/iright.com\/products\/proteintech-25732-1-ap","provider":"Iright","version":"1.0","type":"link"}