{"product_id":"proteintech-25763-1-ap","title":"Proteintech, 25763-1-AP, SNX32 Polyclonal antibody","description":"Size: 20ul \/ 150ul\nThe SNX32 (25763-1-AP) by Proteintech is a Polyclonal antibody targeting SNX32 in WB, IHC, ELISA applications with reactivity to human, mouse samples\n25763-1-AP targets SNX32 in WB, IHC, IF, IP, CoIP, ELISA applications and shows reactivity with human, mouse samples.\n\u003cb\u003eTested Applications\u003c\/b\u003e\nPositive WB detected in: HeLa cells, HepG2 cells,  L02 cells\nPositive IHC detected in: mouse brain tissueNote: suggested antigen retrieval withTE buffer pH 9.0;(*) Alternatively, antigen retrieval may be performed withcitrate buffer pH 6.0\n\u003cb\u003eRecommended dilution\u003c\/b\u003e\nWestern Blot (WB): WB : 1:1000-1:6000\nImmunohistochemistry (IHC): IHC : 1:50-1:500\n\u003cb\u003eBackground Information\u003c\/b\u003e\nSorting nexins are a diverse group of cytoplasmic and membrane-associated proteins that are classified by the presence of a phospholipid-binding motif PX domain (PMID:12461558). They are involved in endocytosis and protein trafficking. SNX32 (Sorting nexin-32, also known as SNX6B) may be involved in several stages of intracellular trafficking.\n\u003cb\u003eSpecification\u003c\/b\u003e\nTested Reactivity: human, mouse\nCited Reactivity: human, pig\nHost \/ Isotype: Rabbit \/ IgG\nClass: Polyclonal\nType: Antibody\nImmunogen: CatNo: Ag22653 Product name: Recombinant human SNX32 protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 218-285 aa of BC040981 Sequence: HTRIRDACLRADRVMRAHKCLADDYIPISAALSSLGTQEVNQLRTSFLKLAELFERLRKLEGRVVSDE Predict reactive species\nFull Name: sorting nexin 32\nCalculated Molecular Weight: 46 kDa\nObserved Molecular Weight: 46 kDa\nGenBank Accession Number: BC040981\nGene Symbol: SNX32\nGene ID (NCBI): 254122\nRRID: AB_2880229\nConjugate: Unconjugated\nForm: Liquid\nPurification Method: Antigen affinity purification\nUNIPROT ID: Q86XE0\nStorage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.\nStorage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.","brand":"Proteintech","offers":[{"title":"Default Title","offer_id":46869769355433,"sku":"25763-1-AP","price":0.99,"currency_code":"USD","in_stock":true}],"url":"https:\/\/iright.com\/products\/proteintech-25763-1-ap","provider":"Iright","version":"1.0","type":"link"}