{"product_id":"proteintech-25766-1-ap","title":"Proteintech, 25766-1-AP, ORAI3 Polyclonal antibody","description":"Size: 20ul \/ 150ul\nThe ORAI3 (25766-1-AP) by Proteintech is a Polyclonal antibody targeting ORAI3 in WB, IHC, ELISA applications with reactivity to human, mouse samples\n25766-1-AP targets ORAI3 in WB, IHC, IF, IP, CoIP, ELISA applications and shows reactivity with human, mouse samples.\n\u003cb\u003eTested Applications\u003c\/b\u003e\nPositive WB detected in: mouse heart tissue, BxPC-3 cells,  LNCaP cells,  PC-3 cells\nPositive IHC detected in: human lung cancer tissueNote: suggested antigen retrieval withTE buffer pH 9.0;(*) Alternatively, antigen retrieval may be performed withcitrate buffer pH 6.0\n\u003cb\u003eRecommended dilution\u003c\/b\u003e\nWestern Blot (WB): WB : 1:200-1:1000\nImmunohistochemistry (IHC): IHC : 1:50-1:500\n\u003cb\u003eBackground Information\u003c\/b\u003e\nORAI3, also named TMEM142C, is a key regulator or component of store-operated Ca2+ channels and transcription factor NFAT nuclear import. ORAI3 channels appeared to differ from Orai1 and -2 in being somewhat resistant to Ca2+ depotentiation. The molecular weight of monomers and dimers for Orai3 is about 30-35 kDa and 60-70 kDa (PMID: 20971921; 17293345; 22580508).\n\u003cb\u003eSpecification\u003c\/b\u003e\nTested Reactivity: human, mouse\nCited Reactivity: human, mouse, rat\nHost \/ Isotype: Rabbit \/ IgG\nClass: Polyclonal\nType: Antibody\nImmunogen: CatNo: Ag22513 Product name: Recombinant human ORAI3 protein Source: e coli. -derived, PET28a Tag: 6*His Domain: 1-100 aa of BC006126 Sequence: MKGGEGDAGEQAPLNPEGESPAGSATYREFVHRGYLDLMGASQHSLRALSWRRLYLSRAKLKASSRTSALLSGFAMVAMVEVQLESDHEYPPGLLVAFSA Predict reactive species\nFull Name: ORAI calcium release-activated calcium modulator 3\nCalculated Molecular Weight: 295 aa, 32 kDa\nObserved Molecular Weight: ~30 kDa, 60 kDa\nGenBank Accession Number: BC006126\nGene Symbol: ORAI3\nGene ID (NCBI): 93129\nRRID: AB_2880231\nConjugate: Unconjugated\nForm: Liquid\nPurification Method: Antigen affinity purification\nUNIPROT ID: Q9BRQ5\nStorage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.\nStorage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.","brand":"Proteintech","offers":[{"title":"Default Title","offer_id":46868971258025,"sku":"25766-1-AP","price":0.99,"currency_code":"USD","in_stock":true}],"url":"https:\/\/iright.com\/products\/proteintech-25766-1-ap","provider":"Iright","version":"1.0","type":"link"}