{"product_id":"proteintech-25768-1-ap","title":"Proteintech, 25768-1-AP, USP19 Polyclonal antibody","description":"Size: 20ul \/ 150ul\nThe USP19 (25768-1-AP) by Proteintech is a Polyclonal antibody targeting USP19 in WB, IP, ELISA applications with reactivity to human samples\n25768-1-AP targets USP19 in WB, IHC, IF, IP, CoIP, ELISA applications and shows reactivity with human samples.\n\u003cb\u003eTested Applications\u003c\/b\u003e\nPositive WB detected in: HeLa cells, MCF-7 cells,  Jurkat cells,  MDA-MB-231 cells\nPositive IP detected in: Jurkat cells\n\u003cb\u003eRecommended dilution\u003c\/b\u003e\nWestern Blot (WB): WB : 1:500-1:3000\nImmunoprecipitation (IP): IP : 0.5-4.0 ug for 1.0-3.0 mg of total protein lysate\n\u003cb\u003eBackground Information\u003c\/b\u003e\nUbiquitin-specific protease (USP)19 is a recently identified deubiquitinating enzyme (DUB) having multiple splice variants and cellular functions. Since the sum of molecular weights of the two small bands (65 kDa+120 kDa) approximates the size of the full-length protein (~185 kDa), USP19 is likely to be endoproteolytically cleaved. Interestingly, the small bands were not observed when the DUB activity was inactivated, suggesting that the cleavage of USP19 depends on its DUB activity (PMID: 25088257).\n\u003cb\u003eSpecification\u003c\/b\u003e\nTested Reactivity: human\nCited Reactivity: human\nHost \/ Isotype: Rabbit \/ IgG\nClass: Polyclonal\nType: Antibody\nImmunogen: CatNo: Ag22646 Product name: Recombinant human USP19 protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 203-500 aa of BC146752 Sequence: VEADEQLCIPPLNSQTCLLGSEENLAPLAGEKAVPPGNDPVSPAMVRSRNPGKDDCAKEEMAVAADAATLVDEPESMVNLAFVKNDSYEKGPDSVVVHVYVKEICRDTSRVLFREQDFTLIFQTRDGNFLRLHPGCGPHTTFRWQVKLRNLIEPEQCTFCFTASRIDICLRKRQSQRWGGLEAPAARVGGAKVAVPTGPTPLDSTPPGGAPHPLTGQEEARAVEKDKSKARSEDTGLDSVATRTPMEHVTPKPETHLASPKPTCMVPPMPHSPVSGDSVEEEEEEEKKVCLPGFTGLV Predict reactive species\nFull Name: ubiquitin specific peptidase 19\nCalculated Molecular Weight: 1318 aa, 146 kDa\nObserved Molecular Weight: 70 kDa, 120 kDa, 150-180 kDa\nGenBank Accession Number: BC146752\nGene Symbol: USP19\nGene ID (NCBI): 10869\nRRID: AB_2713918\nConjugate: Unconjugated\nForm: Liquid\nPurification Method: Antigen affinity purification\nUNIPROT ID: O94966\nStorage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.\nStorage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.","brand":"Proteintech","offers":[{"title":"Default Title","offer_id":46868895662249,"sku":"25768-1-AP","price":0.99,"currency_code":"USD","in_stock":true}],"url":"https:\/\/iright.com\/products\/proteintech-25768-1-ap","provider":"Iright","version":"1.0","type":"link"}