{"product_id":"proteintech-25771-1-ap","title":"Proteintech, 25771-1-AP, G6PC Polyclonal antibody","description":"Size: 20ul \/ 150ul\nThe G6PC (25771-1-AP) by Proteintech is a Polyclonal antibody targeting G6PC in WB, ELISA applications with reactivity to human, rat samples\n25771-1-AP targets G6PC in WB, ELISA applications and shows reactivity with human, rat samples.\n\u003cb\u003eTested Applications\u003c\/b\u003e\nPositive WB detected in: HepG2 cells, L02 cells,  rat liver tissue\n\u003cb\u003eRecommended dilution\u003c\/b\u003e\nWestern Blot (WB): WB : 1:1000-1:6000\n\u003cb\u003eBackground Information\u003c\/b\u003e\nGlucose-6-phosphatase-α (G6PC) is a key enzyme in glucose homeostasis that catalyzes the hydrolysis of glucose-6-phosphate to glucose and phosphate in the terminal step of gluconeogenesis and glycogenolysis. G6PC activity is restricted to the liver, the kidney cortex, and the small intestine and confers on these three organs the capacity to release glucose into the systemic circulation (PMID: 21983240). The encoded enzyme is anchored to the ER by nine transmembrane helices with the amino (N)-terminus in the lumen and the carboxyl (C)-terminus in the cytoplasm (PMID: 15542400).\n\u003cb\u003eSpecification\u003c\/b\u003e\nTested Reactivity: human, rat\nCited Reactivity: mouse\nHost \/ Isotype: Rabbit \/ IgG\nClass: Polyclonal\nType: Antibody\nImmunogen: CatNo: Ag22683 Product name: Recombinant human G6PC protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 1-62 aa of BC136369 Sequence: MEEGMNVLHDFGIQSTHYLQVNYQDSQDWFILVSVIADLRNAFYVLFPIWFHLQEAVGIKLL Predict reactive species\nFull Name: glucose-6-phosphatase, catalytic subunit\nObserved Molecular Weight: 42 kDa\nGenBank Accession Number: BC136369\nGene Symbol: G6PC\nGene ID (NCBI): 2538\nRRID: AB_3669498\nConjugate: Unconjugated\nForm: Liquid\nPurification Method: Antigen affinity purification\nUNIPROT ID: P35575\nStorage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.\nStorage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.","brand":"Proteintech","offers":[{"title":"Default Title","offer_id":46868832845993,"sku":"25771-1-AP","price":0.99,"currency_code":"USD","in_stock":true}],"url":"https:\/\/iright.com\/products\/proteintech-25771-1-ap","provider":"Iright","version":"1.0","type":"link"}