{"product_id":"proteintech-25780-1-ap","title":"Proteintech, 25780-1-AP, MTCL1 Polyclonal antibody","description":"Size: 20ul \/ 150ul\nThe MTCL1 (25780-1-AP) by Proteintech is a Polyclonal antibody targeting MTCL1 in WB, IP, ELISA applications with reactivity to human, canine samples\n25780-1-AP targets MTCL1 in WB, IP, ELISA applications and shows reactivity with human, canine samples.\n\u003cb\u003eTested Applications\u003c\/b\u003e\nPositive WB detected in: HEK-293 cells, HeLa cells,  MDCK cells\nPositive IP detected in: A549 cells\n\u003cb\u003eRecommended dilution\u003c\/b\u003e\nWestern Blot (WB): WB : 1:500-1:1000\nImmunoprecipitation (IP): IP : 0.5-4.0 ug for 1.0-3.0 mg of total protein lysate\n\u003cb\u003eBackground Information\u003c\/b\u003e\nMicrotubule cross‐linking factor 1 (MTCL1) is a MT‐regulating protein that plays essential roles in accumulating the non-centrosomal MTs into the apicobasal MT bundles. MTCL1, identified as a binding protein of the cell polarity‐regulating kinase, PAR‐1b\/MARK2, is recruited to the Golgi membranes through interactions with CLASPs and AKAP450\/CG-NAP, and promotes microtubule growth from the Golgi membrane. Western blot analysis detected MTCL1 at an apparent molecular mass of 250 kDa as indicated in the literature (PMID: 23902687, 28283581).\n\u003cb\u003eSpecification\u003c\/b\u003e\nTested Reactivity: human, canine\nHost \/ Isotype: Rabbit \/ IgG\nClass: Polyclonal\nType: Antibody\nImmunogen: CatNo: Ag22718 Product name: Recombinant human KIAA0802 protein Source: e coli. -derived, PET28a Tag: 6*His Domain: 775-976 aa of BC040542 Sequence: IDHSPVVQDPFQKGLRAGSRSRSAEPRPELGPGQETGTNSRGRSPSPIGVGSEMCREEGGEGTPVKQDLSAPPGYTLTENVARILNKKLLEHALKEERRQAAHGPPGLHSDSHSLGDTAEPGPMEELPCSALAPSLEPCFSRPERPANRRPPSRWAPHSPTASQPQSPGDPTSLEEHGGEEPPEEQPHRDASLHGLSQYNSL Predict reactive species\nFull Name: KIAA0802\nCalculated Molecular Weight: 1905 aa, 209 kDa\nObserved Molecular Weight: 250 kDa\nGenBank Accession Number: BC040542\nGene Symbol: MTCL1\nGene ID (NCBI): 23255\nRRID: AB_3669499\nConjugate: Unconjugated\nForm: Liquid\nPurification Method: Antigen affinity purification\nUNIPROT ID: Q9Y4B5\nStorage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.\nStorage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.","brand":"Proteintech","offers":[{"title":"Default Title","offer_id":46887726186665,"sku":"25780-1-AP","price":0.99,"currency_code":"USD","in_stock":true}],"url":"https:\/\/iright.com\/products\/proteintech-25780-1-ap","provider":"Iright","version":"1.0","type":"link"}