{"product_id":"proteintech-25807-1-ap","title":"Proteintech, 25807-1-AP, ZC3H18 Polyclonal antibody","description":"Size: 20ul \/ 150ul\nThe ZC3H18 (25807-1-AP) by Proteintech is a Polyclonal antibody targeting ZC3H18 in WB, IHC, ELISA applications with reactivity to human samples\n25807-1-AP targets ZC3H18 in WB, IHC, IF, ELISA applications and shows reactivity with human samples.\n\u003cb\u003eTested Applications\u003c\/b\u003e\nPositive WB detected in: HepG2 cells\nPositive IHC detected in: human tonsillitis tissue, human cervical cancer tissueNote: suggested antigen retrieval withTE buffer pH 9.0;(*) Alternatively, antigen retrieval may be performed withcitrate buffer pH 6.0\n\u003cb\u003eRecommended dilution\u003c\/b\u003e\nWestern Blot (WB): WB : 1:500-1:1000\nImmunohistochemistry (IHC): IHC : 1:50-1:500\n\u003cb\u003eBackground Information\u003c\/b\u003e\nZC3H18, also named as NHN1, has two CCCH zinc finger domains. It is not essential in bloodstream forms, but in an in vitro model of differentiation. ZC3H18 recruites the TREX protein for SEP1-mediated mRNA export. The gene ZC3H18 has some isoforms with calculated MW 160 kDa and 84 kDa. With phospho modification, the MW of ZC3H18 is about 150 kDa in WB detection.\n\u003cb\u003eSpecification\u003c\/b\u003e\nTested Reactivity: human\nCited Reactivity: human\nHost \/ Isotype: Rabbit \/ IgG\nClass: Polyclonal\nType: Antibody\nImmunogen: CatNo: Ag20481 Product name: Recombinant human ZC3H18 protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 1-227 aa of BC050463 Sequence: MDVAESPERDPHSPEDEEQPQGLSDDDILRDSGSDQDLDGAGVRASDLEDEESAARGPSQEEEDNHSDEEDRASEPKSQDQDSEVNELSRGPTSSPCEEEGDEGEEDRTSDLRDEASSVTRELDEHELDYDEEVPEEPAPAVQEDEAEKAGAEDDEEKGEGTPREEGKAGVQSVGEKESLEAAKEKKKEDDDGEIDDGEIDDDDLEEGEVKDPSDRKVRPRPTCRFF Predict reactive species\nFull Name: zinc finger CCCH-type containing 18\nCalculated Molecular Weight: 953 aa, 106 kDa\nObserved Molecular Weight: 150 kDa\nGenBank Accession Number: BC050463\nGene Symbol: ZC3H18\nGene ID (NCBI): 124245\nRRID: AB_2721255\nConjugate: Unconjugated\nForm: Liquid\nPurification Method: Antigen affinity purification\nUNIPROT ID: Q86VM9\nStorage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.\nStorage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.","brand":"Proteintech","offers":[{"title":"Default Title","offer_id":46869794554025,"sku":"25807-1-AP","price":0.99,"currency_code":"USD","in_stock":true}],"url":"https:\/\/iright.com\/products\/proteintech-25807-1-ap","provider":"Iright","version":"1.0","type":"link"}