{"product_id":"proteintech-25816-1-ap","title":"Proteintech, 25816-1-AP, FAM125A Polyclonal antibody","description":"Size: 20ul \/ 150ul\nThe FAM125A (25816-1-AP) by Proteintech is a Polyclonal antibody targeting FAM125A in WB, IHC, IF\/ICC, ELISA applications with reactivity to human samples\n25816-1-AP targets FAM125A in WB, IHC, IF\/ICC, ELISA applications and shows reactivity with human samples.\n\u003cb\u003eTested Applications\u003c\/b\u003e\nPositive WB detected in: Jurkat cells\nPositive IHC detected in: human pancreas tissueNote: suggested antigen retrieval withTE buffer pH 9.0;(*) Alternatively, antigen retrieval may be performed withcitrate buffer pH 6.0\nPositive IF\/ICC detected in: HeLa cells\n\u003cb\u003eRecommended dilution\u003c\/b\u003e\nWestern Blot (WB): WB : 1:500-1:2000\nImmunohistochemistry (IHC): IHC : 1:50-1:500\nImmunofluorescence (IF)\/ICC: IF\/ICC : 1:10-1:100\n\u003cb\u003eBackground Information\u003c\/b\u003e\nFAM125A, also named as MVB12A and CFBP, is a component of the ESCRT-I complex. FAM125A is required for the sorting of endocytic ubiquitinated cargos into multivesicular bodies. FAM125A has three isoforms with MW 27-28 kDa and 25 kDa.\n\u003cb\u003eSpecification\u003c\/b\u003e\nTested Reactivity: human\nHost \/ Isotype: Rabbit \/ IgG\nClass: Polyclonal\nType: Antibody\nImmunogen: CatNo: Ag22919 Product name: Recombinant human FAM125A protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 1-214 aa of BC007883 Sequence: MDPVPGTDSAPLAGLAWSSASAPPPRGFSAISCTVEGAPASFGKSFAQKSGYFLCLSSLGSLENPQENVVADIQIVVDKSPLPLGFSPVCDPMDSKASVSKKKRMCVKLLPLGATDTAVFDVRLSGKTKTVPGYLRIGDMGGFAIWCKKAKAPRPVPKPRGLSRDMQGLSLDAASQPSKGGLLERTASRLGSRASTLRRNDSIYEASSLYGISA Predict reactive species\nFull Name: family with sequence similarity 125, member A\nCalculated Molecular Weight: 273 aa, 29 kDa\nObserved Molecular Weight: 30 kDa\nGenBank Accession Number: BC007883\nGene Symbol: FAM125A\nGene ID (NCBI): 93343\nRRID: AB_2880250\nConjugate: Unconjugated\nForm: Liquid\nPurification Method: Antigen affinity purification\nUNIPROT ID: Q96EY5\nStorage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.\nStorage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.","brand":"Proteintech","offers":[{"title":"Default Title","offer_id":46887630799017,"sku":"25816-1-AP","price":0.99,"currency_code":"USD","in_stock":true}],"url":"https:\/\/iright.com\/products\/proteintech-25816-1-ap","provider":"Iright","version":"1.0","type":"link"}