{"product_id":"proteintech-25822-1-ap","title":"Proteintech, 25822-1-AP, CCDC33 Polyclonal antibody","description":"Size: 20ul \/ 150ul\nThe CCDC33 (25822-1-AP) by Proteintech is a Polyclonal antibody targeting CCDC33 in WB, IP, ELISA applications with reactivity to human, mouse, rat samples\n25822-1-AP targets CCDC33 in WB, IP, ELISA applications and shows reactivity with human, mouse, rat samples.\n\u003cb\u003eTested Applications\u003c\/b\u003e\nPositive WB detected in: rat testis tissue\nPositive IP detected in: mouse testis tissue\n\u003cb\u003eRecommended dilution\u003c\/b\u003e\nWestern Blot (WB): WB : 1:500-1:2000\nImmunoprecipitation (IP): IP : 0.5-4.0 ug for 1.0-3.0 mg of total protein lysate\n\u003cb\u003eBackground Information\u003c\/b\u003e\nThe human CCDC33 gene was reported to encode a cancer\/testis (CT) antigen, which is located on 15q24.1, spans a region of 99.8 kb, and consists of 20 exons (PMID: 28639886). CCDC33 is predominantly expressed in the testis and undergoes alternative splicing to produce at least 5 different transcripts (37kda, 41kda, 85kda, 107kda, 114kda). Human CCDC33 was reported to be a cancer\/testis (CT) protein.  Abundant expression of Ccdc33 is evident during mouse spermatogenesis (PMID: 33942254).\n\u003cb\u003eSpecification\u003c\/b\u003e\nTested Reactivity: human, mouse, rat\nHost \/ Isotype: Rabbit \/ IgG\nClass: Polyclonal\nType: Antibody\nImmunogen: CatNo: Ag22893 Product name: Recombinant human CCDC33 protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 1-206 aa of BC025689 Sequence: SEMNNYRRAMQKMAEDILSLRRQASILEGENRILRSRLAQQEEEEGQGKASEAQNTVSMKQKLLLSELDMKKLRDRVQHLQNELIRKNDREKELLLLYQAQQPQAALLKQYQGKLQKMKALEETVRHQEKVIEKMERVLEDRLQDRSKPPPLNRQQGKPYTGFPMLSASGLPLGSMGENLPVELYSVLLAENAKLRTELDKNRHQQ Predict reactive species\nFull Name: coiled-coil domain containing 33\nCalculated Molecular Weight: 958 aa, 107 kDa\nObserved Molecular Weight: 85 kDa\nGenBank Accession Number: BC025689\nGene Symbol: CCDC33\nGene ID (NCBI): 80125\nConjugate: Unconjugated\nForm: Liquid\nPurification Method: Antigen affinity purification\nUNIPROT ID: Q8N5R6\nStorage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.\nStorage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.","brand":"Proteintech","offers":[{"title":"Default Title","offer_id":46885951504553,"sku":"25822-1-AP","price":0.99,"currency_code":"USD","in_stock":true}],"url":"https:\/\/iright.com\/products\/proteintech-25822-1-ap","provider":"Iright","version":"1.0","type":"link"}