{"product_id":"proteintech-25846-1-ap","title":"Proteintech, 25846-1-AP, AVEN Polyclonal antibody","description":"Size: 20ul \/ 150ul\nThe AVEN (25846-1-AP) by Proteintech is a Polyclonal antibody targeting AVEN in WB, IHC, ELISA applications with reactivity to human samples\n25846-1-AP targets AVEN in WB, IHC, ELISA applications and shows reactivity with human samples.\n\u003cb\u003eTested Applications\u003c\/b\u003e\nPositive WB detected in: MCF-7 cells,  K-562 cells\nPositive IHC detected in: human colon tissueNote: suggested antigen retrieval withTE buffer pH 9.0;(*) Alternatively, antigen retrieval may be performed withcitrate buffer pH 6.0\n\u003cb\u003eRecommended dilution\u003c\/b\u003e\nWestern Blot (WB): WB : 1:500-1:2000\nImmunohistochemistry (IHC): IHC : 1:50-1:500\n\u003cb\u003eBackground Information\u003c\/b\u003e\nAVEN (Apoptosis caspase activation inhibitor) is known to play a role in male and female germ cell development. AVEN protein has also been shown to inhibit the mitochondrial apoptosis pathway by binding to and inhibiting the self-association of proapoptotic APAF-1, as well as binding to and enhancing antiapoptotic BCL-xL activity. AVEN has also recently been shown to function as an activator of the cell cycle-regulating ATM kinase in the DNA damage response pathway. Molecular weight of this protein detected by WB is 50 kDa (PMID: 22751129).\n\u003cb\u003eSpecification\u003c\/b\u003e\nTested Reactivity: human\nCited Reactivity: human\nHost \/ Isotype: Rabbit \/ IgG\nClass: Polyclonal\nType: Antibody\nImmunogen: CatNo: Ag23020 Product name: Recombinant human AVEN protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 1-362 aa of BC010488 Sequence: MQAERGARGGRGRRPGRGRPGGDRHSERPGAAAAVARGGGGGGGGDGGGRRGRGRGRGFRGARGGRGGGGAPRGSRREPGGWGAGASAPVEDDSDAETYGEENDEQGNYSKRKIVSNWDRYQDIEKEVNNESGESQRGTDFSVLLSSAGDSFSQFRFAEEKEWDSEASCPKQNSAFYVDSELLVRALQELPLCLRLNVAAELVQGTVPLEVPQVKPKRTDDGKGLGMQLKGPLGPGGRGPIFELKSVAAGCPVLLGKDNPSPGPSRDSQKPTSPLQSAGDHLEEELDLLLNLDAPIKEGDNILPDQTSQDLKSKEDGEVVQEEEVCAKPSVTEEKNMEPEQPSTSKNVTEEELEDWLDSMIS Predict reactive species\nFull Name: apoptosis, caspase activation inhibitor\nCalculated Molecular Weight: 39 kDa\nObserved Molecular Weight: 50 kDa\nGenBank Accession Number: BC010488\nGene Symbol: AVEN\nGene ID (NCBI): 57099\nRRID: AB_2880266\nConjugate: Unconjugated\nForm: Liquid\nPurification Method: Antigen affinity purification\nUNIPROT ID: Q9NQS1\nStorage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.\nStorage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.","brand":"Proteintech","offers":[{"title":"Default Title","offer_id":46869517107369,"sku":"25846-1-AP","price":0.99,"currency_code":"USD","in_stock":true}],"url":"https:\/\/iright.com\/products\/proteintech-25846-1-ap","provider":"Iright","version":"1.0","type":"link"}