{"product_id":"proteintech-25871-1-ap","title":"Proteintech, 25871-1-AP, Progesterone Receptor Polyclonal antibody","description":"Size: 20ul \/ 150ul\nThe Progesterone Receptor (25871-1-AP) by Proteintech is a Polyclonal antibody targeting Progesterone Receptor in WB, IHC, IF\/ICC, IF-P, ELISA applications with reactivity to human, mouse samples\n25871-1-AP targets Progesterone Receptor in WB, IHC, IF\/ICC, IF-P, ELISA applications and shows reactivity with human, mouse samples.\n\u003cb\u003eTested Applications\u003c\/b\u003e\nPositive WB detected in: T-47D cells\nPositive IHC detected in: human breast cancer tissue, human ovary tumor tissueNote: suggested antigen retrieval withTE buffer pH 9.0;(*) Alternatively, antigen retrieval may be performed withcitrate buffer pH 6.0\nPositive IF-P detected in: human breast cancer tissue\nPositive IF\/ICC detected in: T-47D cells\n\u003cb\u003eRecommended dilution\u003c\/b\u003e\nWestern Blot (WB): WB : 1:5000-1:50000\nImmunohistochemistry (IHC): IHC : 1:200-1:800\nImmunofluorescence (IF)-P: IF-P : 1:250-1:1000\nImmunofluorescence (IF)\/ICC: IF\/ICC : 1:50-1:500\n\u003cb\u003eBackground Information\u003c\/b\u003e\nPGR (Progesterone Receptor), also named as NR3C3 and PR, belongs to the nuclear hormone receptor family and NR3 subfamily. The steroid hormones and their receptors are involved in the regulation of eukaryotic gene expression and affect cellular proliferation and differentiation in target tissues. Progesterone receptor isoform B (PRB) is involved activation of c-SRC\/MAPK signaling on hormone stimulation. The ER and PR status has been used as a predictor of breast carcinoma responsiveness to endocrine therapy and as a prognostic indicator for early recurrence. This antibody recognizes both PR-A and PR-B.\n\u003cb\u003eSpecification\u003c\/b\u003e\nTested Reactivity: human, mouse\nCited Reactivity: human, mouse, rat, pig, goat\nHost \/ Isotype: Rabbit \/ IgG\nClass: Polyclonal\nType: Antibody\nImmunogen: CatNo: Ag22986 Product name: Recombinant human PR protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 1-301 aa of NM_000926 Sequence: MTELKAKGPRAPHVAGGPPSPEVGSPLLCRPAAGPFPGSQTSDTLPEVSAIPISLDGLLFPRPCQGQDPSDEKTQDQQSLSDVEGAYSRAEATRGAGGSSSSPPEKDSGLLDSVLDTLLAPSGPGQSQPSPPACEVTSSWCLFGPELPEDPPAAPATQRVLSPLMSRSGCKVGDSSGTAAAHKVLPRGLSPARQLLLPASESPHWSGAPVKPSPQAAAVEVEEEDGSESEESAGPLLKGKPRALGGAAAGGGAAAVPPGAAAGGVALVPKEDSRFSAPRVALVEQDAPMAPGRSPLATTVM Predict reactive species\nFull Name: progesterone receptor\nCalculated Molecular Weight: 933 aa, 99 kDa\nObserved Molecular Weight: 80 kDa, 110-115 kDa\nGenBank Accession Number: NM_000926\nGene Symbol: Progesterone Receptor\nGene ID (NCBI): 5241\nRRID: AB_2880277\nConjugate: Unconjugated\nForm: Liquid\nPurification Method: Antigen affinity purification\nUNIPROT ID: P06401\nStorage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.\nStorage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.","brand":"Proteintech","offers":[{"title":"Default Title","offer_id":46868856963241,"sku":"25871-1-AP","price":0.99,"currency_code":"USD","in_stock":true}],"url":"https:\/\/iright.com\/products\/proteintech-25871-1-ap","provider":"Iright","version":"1.0","type":"link"}