{"product_id":"proteintech-25889-1-ap","title":"Proteintech, 25889-1-AP, LIPF Polyclonal antibody","description":"Size: 20ul \/ 150ul\nThe LIPF (25889-1-AP) by Proteintech is a Polyclonal antibody targeting LIPF in WB, IHC, ELISA applications with reactivity to human, mouse samples\n25889-1-AP targets LIPF in WB, IHC, ELISA applications and shows reactivity with human, mouse samples.\n\u003cb\u003eTested Applications\u003c\/b\u003e\nPositive WB detected in: MKN-45 cells, mouse stomach tissue\nPositive IHC detected in: human stomach tissue, human liver tissueNote: suggested antigen retrieval withTE buffer pH 9.0;(*) Alternatively, antigen retrieval may be performed withcitrate buffer pH 6.0\n\u003cb\u003eRecommended dilution\u003c\/b\u003e\nWestern Blot (WB): WB : 1:200-1:1000\nImmunohistochemistry (IHC): IHC : 1:50-1:500\n\u003cb\u003eBackground Information\u003c\/b\u003e\ngastric lipase, is an enzyme involved in the digestion of dietary triglycerides in the gastrointestinal tract, and responsible for 30% of fat digestion processes occurring in human. It is secreted by gastric chief cells in the fundic mucosa of the stomach, and it hydrolyzes the ester bonds of triglycerides under acidic pH conditions.\n\u003cb\u003eSpecification\u003c\/b\u003e\nTested Reactivity: human, mouse\nHost \/ Isotype: Rabbit \/ IgG\nClass: Polyclonal\nType: Antibody\nImmunogen: CatNo: Ag23149 Product name: Recombinant human LIPF protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 299-398 aa of BC112272 Sequence: KSGKFQAYDWGSPVQNRMHYDQSQPPYYNVTAMNVPIAVWNGGKDLLADPQDVGLLLPKLPNLIYHKEIPFYNHLDFIWAMDAPQEVYNDIVSMISEDKK Predict reactive species\nFull Name: lipase, gastric\nObserved Molecular Weight: 49 kDa\nGenBank Accession Number: BC112272\nGene Symbol: LIPF\nGene ID (NCBI): 8513\nRRID: AB_2880284\nConjugate: Unconjugated\nForm: Liquid\nPurification Method: Antigen affinity purification\nUNIPROT ID: P07098\nStorage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.\nStorage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.","brand":"Proteintech","offers":[{"title":"Default Title","offer_id":46887704264873,"sku":"25889-1-AP","price":0.99,"currency_code":"USD","in_stock":true}],"url":"https:\/\/iright.com\/products\/proteintech-25889-1-ap","provider":"Iright","version":"1.0","type":"link"}