{"product_id":"proteintech-25891-1-ap","title":"Proteintech, 25891-1-AP, C9 Polyclonal antibody","description":"Size: 20ul \/ 150ul\nThe C9 (25891-1-AP) by Proteintech is a Polyclonal antibody targeting C9 in WB, ELISA applications with reactivity to human samples\n25891-1-AP targets C9 in WB, ELISA applications and shows reactivity with human samples.\n\u003cb\u003eTested Applications\u003c\/b\u003e\nPositive WB detected in: human plasma\n\u003cb\u003eRecommended dilution\u003c\/b\u003e\nWestern Blot (WB): WB : 1:1000-1:8000\n\u003cb\u003eBackground Information\u003c\/b\u003e\nThe final consequence of complement activation is the formation of the membrane attack complex (MAC), a multiprotein assembly that perforates cell membranes, forming transmembrane channels. The MAC plays a critical role in complement-mediated hemolysis and inflammasome activation (PMID: 27444648). Complement component 9 (C9) is 1 of 5 late-acting proteins of complement that participate in the assembly and function of the MAC. C9 may be cleaved by thrombin to generate fragments C9a (25 kDa) and C9b (37 kDa) (PMID: 7523406).\n\u003cb\u003eSpecification\u003c\/b\u003e\nTested Reactivity: human\nHost \/ Isotype: Rabbit \/ IgG\nClass: Polyclonal\nType: Antibody\nImmunogen: CatNo: Ag23137 Product name: Recombinant human C9 protein Source: e coli. -derived, PET30a Tag: 6*His Domain: 22-313 aa of BC020721 Sequence: QYTTSYDPELTESSGSASHIDCRMSPWSEWSQCDPCLRQMFRSRSIEVFGQFNGKRCTDAVGDRRQCVPTEPCEDAEDDCGNDFQCSTGRCIKMRLRCNGDNDCGDFSDEDDCESEPRPPCRDRVVEESELARTAGYGINILGMDPLSTPFDNEFYNGLCNRDRDGNTLTYYRRPWNVASLIYETKGEKNFRTEHYEEQIEAFKSIIQEKTSNFNAAISLKFTPTETNKAEQCCEETASSISLHGKGSFRFSYSKNETYQLFLSYSSKKEKMFLHVKGEIHLGRFVMRNRDV Predict reactive species\nFull Name: complement component 9\nCalculated Molecular Weight: 559 aa, 63 kDa\nObserved Molecular Weight: 64 kDa\nGenBank Accession Number: BC020721\nGene Symbol: C9\nGene ID (NCBI): 735\nRRID: AB_3085827\nConjugate: Unconjugated\nForm: Liquid\nPurification Method: Antigen affinity purification\nUNIPROT ID: P02748\nStorage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.\nStorage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.","brand":"Proteintech","offers":[{"title":"Default Title","offer_id":46885670879401,"sku":"25891-1-AP","price":0.99,"currency_code":"USD","in_stock":true}],"url":"https:\/\/iright.com\/products\/proteintech-25891-1-ap","provider":"Iright","version":"1.0","type":"link"}