{"product_id":"proteintech-25917-1-ap","title":"Proteintech, 25917-1-AP, GMIP Polyclonal antibody","description":"Size: 20ul \/ 150ul\nThe GMIP (25917-1-AP) by Proteintech is a Polyclonal antibody targeting GMIP in WB, IHC, IP, ELISA applications with reactivity to human samples\n25917-1-AP targets GMIP in WB, IHC, IF, IP, ELISA applications and shows reactivity with human samples.\n\u003cb\u003eTested Applications\u003c\/b\u003e\nPositive WB detected in: Jurkat cells, K-562 cells\nPositive IP detected in: Jurkat cells\nPositive IHC detected in: human ovary cancer tissueNote: suggested antigen retrieval withTE buffer pH 9.0;(*) Alternatively, antigen retrieval may be performed withcitrate buffer pH 6.0\n\u003cb\u003eRecommended dilution\u003c\/b\u003e\nWestern Blot (WB): WB : 1:1000-1:4000\nImmunoprecipitation (IP): IP : 0.5-4.0 ug for 1.0-3.0 mg of total protein lysate\nImmunohistochemistry (IHC): IHC : 1:50-1:500\n\u003cb\u003eBackground Information\u003c\/b\u003e\nGMIP (Gem-interacting protein) is a 970 amino acid protein that stimulates the GTPase activity of RhoA in vitro and in vivo. GMIP interacts with Gem through its N-terminus and has a Rho GTPase-activating protein domain at its C-terminus. The Rho family of GTP-binding proteins plays a role in the development of neuronal structure. GMIP is able to inhibit RhoA function, leading to Actin cytoskeletal reorganization in vivo.\n\u003cb\u003eSpecification\u003c\/b\u003e\nTested Reactivity: human\nCited Reactivity: human\nHost \/ Isotype: Rabbit \/ IgG\nClass: Polyclonal\nType: Antibody\nImmunogen: CatNo: Ag23239 Product name: Recombinant human GMIP protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 1-91 aa of BC126436 Sequence: MDAAEPGLPPGPEGRKRYSDIFRSLDNLEISLGNVTLEMLAGDPLLSEDPEPDKTPTATVTNEASCWSGPSPEGPVPLTGEELDLRLIRTK Predict reactive species\nFull Name: GEM interacting protein\nObserved Molecular Weight: 130 kDa\nGenBank Accession Number: BC126436\nGene Symbol: GMIP\nGene ID (NCBI): 51291\nRRID: AB_2880295\nConjugate: Unconjugated\nForm: Liquid\nPurification Method: Antigen affinity purification\nUNIPROT ID: Q9P107\nStorage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.\nStorage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.","brand":"Proteintech","offers":[{"title":"Default Title","offer_id":46869688123561,"sku":"25917-1-AP","price":0.99,"currency_code":"USD","in_stock":true}],"url":"https:\/\/iright.com\/products\/proteintech-25917-1-ap","provider":"Iright","version":"1.0","type":"link"}