{"product_id":"proteintech-25918-1-ap","title":"Proteintech, 25918-1-AP, RRN3 Polyclonal antibody","description":"Size: 20ul \/ 150ul\nThe RRN3 (25918-1-AP) by Proteintech is a Polyclonal antibody targeting RRN3 in WB, IHC, IP, ELISA applications with reactivity to human, mouse samples\n25918-1-AP targets RRN3 in WB, IHC, IP, chIP, ELISA applications and shows reactivity with human, mouse samples.\n\u003cb\u003eTested Applications\u003c\/b\u003e\nPositive WB detected in: Jurkat cells, HeLa cells,  K-562 cells,  mouse testis tissue\nPositive IP detected in: HeLa cells\nPositive IHC detected in: mouse testis tissueNote: suggested antigen retrieval withTE buffer pH 9.0;(*) Alternatively, antigen retrieval may be performed withcitrate buffer pH 6.0\n\u003cb\u003eRecommended dilution\u003c\/b\u003e\nWestern Blot (WB): WB : 1:1000-1:4000\nImmunoprecipitation (IP): IP : 0.5-4.0 ug for 1.0-3.0 mg of total protein lysate\nImmunohistochemistry (IHC): IHC : 1:250-1:1000\n\u003cb\u003eBackground Information\u003c\/b\u003e\nRRN3, also known as transcription initiation factor IA, is a key regulatory protein essential for RNA polymerase I-mediated ribosomal DNA transcription. It functions as a bridge molecule that precisely regulates the recruitment of RNA polymerase I to the rDNA promoter and the assembly of the transcription initiation complex by integrating intra- and extracellular signals (such as growth factors, nutrient status, and cellular stress). \nThe activity of RRN3 is tightly controlled by multiple signaling pathways. Specifically, the mTOR and MAPK pathways can activate RRN3 through phosphorylation, thereby promoting ribosomal RNA synthesis and ultimately influencing cell growth and proliferation. Studies have shown that RRN3 is abnormally highly expressed in various cancer cells and is closely associated with malignant tumor progression, making it a potential therapeutic target for anticancer strategies.\n\u003cb\u003eSpecification\u003c\/b\u003e\nTested Reactivity: human, mouse\nCited Reactivity: human\nHost \/ Isotype: Rabbit \/ IgG\nClass: Polyclonal\nType: Antibody\nImmunogen: CatNo: Ag23207 Product name: Recombinant human RRN3 protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 268-365 aa of BC132688 Sequence: ETATQTCGGTDSTEGLFNMDEDEETEHETKAGPERLDQMVHPVAERLDILMSLVLSYMKDVCYVDGKVDNGKTKDLYRDLINIFDKLLLPTHASCHVQ Predict reactive species\nFull Name: RRN3 RNA polymerase I transcription factor homolog (S. cerevisiae)\nObserved Molecular Weight: 74 kDa\nGenBank Accession Number: BC132688\nGene Symbol: RRN3\nGene ID (NCBI): 54700\nRRID: AB_2880296\nConjugate: Unconjugated\nForm: Liquid\nPurification Method: Antigen affinity purification\nUNIPROT ID: Q9NYV6\nStorage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.\nStorage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.","brand":"Proteintech","offers":[{"title":"Default Title","offer_id":46869495480489,"sku":"25918-1-AP","price":0.99,"currency_code":"USD","in_stock":true}],"url":"https:\/\/iright.com\/products\/proteintech-25918-1-ap","provider":"Iright","version":"1.0","type":"link"}