{"product_id":"proteintech-25958-1-ap","title":"Proteintech, 25958-1-AP, SLC19A1 Polyclonal antibody","description":"Size: 20ul \/ 150ul\nThe SLC19A1 (25958-1-AP) by Proteintech is a Polyclonal antibody targeting SLC19A1 in WB, IHC, ELISA applications with reactivity to human, mouse samples\n25958-1-AP targets SLC19A1 in WB, IHC, IF, ELISA applications and shows reactivity with human, mouse samples.\n\u003cb\u003eTested Applications\u003c\/b\u003e\nPositive WB detected in: HepG2 cells, LNCaP cells\nPositive IHC detected in: human placenta tissue, mouse cerebellum tissueNote: suggested antigen retrieval withTE buffer pH 9.0;(*) Alternatively, antigen retrieval may be performed withcitrate buffer pH 6.0\n\u003cb\u003eRecommended dilution\u003c\/b\u003e\nWestern Blot (WB): WB : 1:500-1:2000\nImmunohistochemistry (IHC): IHC : 1:50-1:500\n\u003cb\u003eBackground Information\u003c\/b\u003e\nSLC19A1, also named as RFC (reduced folate carrier), is an anionic exchanger that involved in the regulation of intracellular concentrations of folate in exchange for anions. The predicted MW of  SLC19A1 is 65 kDa and 25958-1-AP antibody recognizes the 46 kDa protein which is similar to papers. The 38-40 kDa minor forms and 58 kDa form have also been reported that could be alternate splicing, post-transcriptional modification or the role of accessory proteins. (PMID: 17404734, 9111015)\n\u003cb\u003eSpecification\u003c\/b\u003e\nTested Reactivity: human, mouse\nCited Reactivity: human, mouse\nHost \/ Isotype: Rabbit \/ IgG\nClass: Polyclonal\nType: Antibody\nImmunogen: CatNo: Ag22921 Product name: Recombinant human SLC19A1 protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 197-266 aa of BC003068 Sequence: VVLALFLKRPKRSLFFNRDDRGRCETSASELERMNPGPGGKLGHALRVACGDSVLARMLRELGDSLRRPQ Predict reactive species\nFull Name: solute carrier family 19 (folate transporter), member 1\nCalculated Molecular Weight: 591 aa, 65 kDa\nObserved Molecular Weight: 46 kDa\nGenBank Accession Number: BC003068\nGene Symbol: SLC19A1\nGene ID (NCBI): 6573\nRRID: AB_2880310\nConjugate: Unconjugated\nForm: Liquid\nPurification Method: Antigen affinity purification\nUNIPROT ID: P41440\nStorage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.\nStorage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.","brand":"Proteintech","offers":[{"title":"Default Title","offer_id":46869430763689,"sku":"25958-1-AP","price":0.99,"currency_code":"USD","in_stock":true}],"url":"https:\/\/iright.com\/products\/proteintech-25958-1-ap","provider":"Iright","version":"1.0","type":"link"}