{"product_id":"proteintech-25979-1-ap","title":"Proteintech, 25979-1-AP, JPH1 Polyclonal antibody","description":"Size: 20ul \/ 150ul\nThe JPH1 (25979-1-AP) by Proteintech is a Polyclonal antibody targeting JPH1 in WB, IHC, ELISA applications with reactivity to human, mouse, rat samples\n25979-1-AP targets JPH1 in WB, IHC, ELISA applications and shows reactivity with human, mouse, rat samples.\n\u003cb\u003eTested Applications\u003c\/b\u003e\nPositive WB detected in: HEK-293 cells, mouse heart tissue,  rat heart tissue\nPositive IHC detected in: human skeletal muscle tissue, human skin tissueNote: suggested antigen retrieval withTE buffer pH 9.0;(*) Alternatively, antigen retrieval may be performed withcitrate buffer pH 6.0\n\u003cb\u003eRecommended dilution\u003c\/b\u003e\nWestern Blot (WB): WB : 1:1000-1:4000\nImmunohistochemistry (IHC): IHC : 1:50-1:500\n\u003cb\u003eBackground Information\u003c\/b\u003e\nJunctophilin-1 is a protein that in humans is encoded by the JPH1 gene. This gene is a member of the junctophilin gene family. Junctional complexes between the plasma membrane and endoplasmic\/sarcoplasmic reticulum are a common feature of all excitable cell types and mediate cross talk between cell surface and intracellular ion channels. The protein encoded by this gene is a component of junctional complexes and is composed of a C-terminal hydrophobic segment spanning the endoplasmic\/sarcoplasmic reticulum membrane and a remaining cytoplasmic domain that shows specific affinity for the plasma membrane.\n\u003cb\u003eSpecification\u003c\/b\u003e\nTested Reactivity: human, mouse, rat\nHost \/ Isotype: Rabbit \/ IgG\nClass: Polyclonal\nType: Antibody\nImmunogen: CatNo: Ag23270 Product name: Recombinant human JPH1 protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 464-639 aa of BC140875 Sequence: RSPEASPKHSHSPASSPKPLKKQNPSSGARLNQDKRSVADEQVTAIVNKPLMSKAPTKEAGAVVPQSKYSGRHHIPNPSNGELHSQYHGYYVKLNAPQHPPVDVEDGDGSSQSSSALVHKPSANKWSPSKSVTKPVAKESKAEPKAKKSELAIPKNPASNDSCPALEKEANSGPNS Predict reactive species\nFull Name: junctophilin 1\nCalculated Molecular Weight: 72 kDa\nObserved Molecular Weight: 72 kDa\nGenBank Accession Number: BC140875\nGene Symbol: JPH1\nGene ID (NCBI): 56704\nRRID: AB_2880317\nConjugate: Unconjugated\nForm: Liquid\nPurification Method: Antigen affinity purification\nUNIPROT ID: Q9HDC5\nStorage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.\nStorage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.","brand":"Proteintech","offers":[{"title":"Default Title","offer_id":46887689322665,"sku":"25979-1-AP","price":0.99,"currency_code":"USD","in_stock":true}],"url":"https:\/\/iright.com\/products\/proteintech-25979-1-ap","provider":"Iright","version":"1.0","type":"link"}