{"product_id":"proteintech-25999-1-ap","title":"Proteintech, 25999-1-AP, GPR87 Polyclonal antibody","description":"Size: 20ul \/ 150ul\nThe GPR87 (25999-1-AP) by Proteintech is a Polyclonal antibody targeting GPR87 in IHC, ELISA applications with reactivity to human, mouse samples\n25999-1-AP targets GPR87 in IHC, ELISA applications and shows reactivity with human, mouse samples.\n\u003cb\u003eTested Applications\u003c\/b\u003e\nPositive IHC detected in: mouse bladder tissueNote: suggested antigen retrieval withTE buffer pH 9.0;(*) Alternatively, antigen retrieval may be performed withcitrate buffer pH 6.0\n\u003cb\u003eRecommended dilution\u003c\/b\u003e\nImmunohistochemistry (IHC): IHC : 1:50-1:500\n\u003cb\u003eBackground Information\u003c\/b\u003e\nG Protein-Coupled Receptor 87 (GPR87) is a GPCR, and it has been demonstrated to regulate the progression of several tumors (PMID:18183596). Studied reported that GPR87 promotes PDA (Pancreatic ductal adenocarcinoma) proliferation, angiogenesis, gemcitabine resistance, and tumorigenicity through activating the nuclear factor-kB (NF-kB) pathway (PMID:32405536). GPR87 is an independent prognostic factor for bladder cancer intravesical recurrence; it promotes bladder cancer cell proliferation and inhibits apoptosis. In addition, GPR87 was deorphanized and shown to be a lysophosphatidic acid (LPA) receptor (PMID:23752273).\n\u003cb\u003eSpecification\u003c\/b\u003e\nTested Reactivity: human, mouse\nHost \/ Isotype: Rabbit \/ IgG\nClass: Polyclonal\nType: Antibody\nImmunogen: CatNo: Ag23214 Product name: Recombinant human GPR87 protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 1-47 aa of BC132888 Sequence: MGFNLTLAKLPNNELHGQESHNSGNRSDGPGKNTTLHNEFDTIVLPV Predict reactive species\nFull Name: G protein-coupled receptor 87\nGenBank Accession Number: BC132888\nGene Symbol: GPR87\nGene ID (NCBI): 53836\nRRID: AB_3085833\nConjugate: Unconjugated\nForm: Liquid\nPurification Method: Antigen affinity purification\nUNIPROT ID: Q9BY21\nStorage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.\nStorage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.","brand":"Proteintech","offers":[{"title":"Default Title","offer_id":46887658586281,"sku":"25999-1-AP","price":0.99,"currency_code":"USD","in_stock":true}],"url":"https:\/\/iright.com\/products\/proteintech-25999-1-ap","provider":"Iright","version":"1.0","type":"link"}