{"product_id":"proteintech-26006-1-ap","title":"Proteintech, 26006-1-AP, SLIRP Polyclonal antibody","description":"Size: 20ul \/ 150ul\nThe SLIRP (26006-1-AP) by Proteintech is a Polyclonal antibody targeting SLIRP in WB, IHC, IF\/ICC, ELISA applications with reactivity to human, mouse samples\n26006-1-AP targets SLIRP in WB, IHC, IF\/ICC, CoIP, ELISA applications and shows reactivity with human, mouse samples.\n\u003cb\u003eTested Applications\u003c\/b\u003e\nPositive WB detected in: HeLa cells, PC-3 cells,  MDA-MB-453s cells\nPositive IHC detected in: human ovary cancer tissue, human kidney tissue,  human stomach cancer tissue,  mouse testis tissueNote: suggested antigen retrieval withTE buffer pH 9.0;(*) Alternatively, antigen retrieval may be performed withcitrate buffer pH 6.0\nPositive IF\/ICC detected in: PC-3 cells\n\u003cb\u003eRecommended dilution\u003c\/b\u003e\nWestern Blot (WB): WB : 1:1000-1:4000\nImmunohistochemistry (IHC): IHC : 1:50-1:500\nImmunofluorescence (IF)\/ICC: IF\/ICC : 1:50-1:500\n\u003cb\u003eBackground Information\u003c\/b\u003e\nSLIRP, also named as C14orf156, DC23, DC50 and PD04872. It is an RNA-binding protein on steroid receptor RNA activator (SRA), and its expression is ubiquitous in human normal tissues. SLIRP can affect mitochondrial mRNA transcription and energy conversion. In addition, the loss or weakening of SLIRP destroys part of the structure of mitochondria, affects mitochondria energy metabolism, and increases sperm or cell oxidative stress damage (PMID: 33150185). SLIRP has 2 isoforms with the molecular mass of  12 kDa.\n\u003cb\u003eSpecification\u003c\/b\u003e\nTested Reactivity: human, mouse\nCited Reactivity: human\nHost \/ Isotype: Rabbit \/ IgG\nClass: Polyclonal\nType: Antibody\nImmunogen: CatNo: Ag22945 Product name: Recombinant human C14orf156 protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 1-109 aa of BC017895 Sequence: MAASAARGAAALRRSINQPVAFVRRIPWTAASSQLKEHFAQFGHVRRCILPFDKETGFHRGLGWVQFSSEEGLRNALQQENHIIDGVKVQVHTRRPKLPQTSDDEKKDF Predict reactive species\nFull Name: chromosome 14 open reading frame 156\nCalculated Molecular Weight: 109 aa, 12 kDa\nObserved Molecular Weight: 12 kDa\nGenBank Accession Number: BC017895\nGene Symbol: SLIRP\nGene ID (NCBI): 81892\nRRID: AB_2880332\nConjugate: Unconjugated\nForm: Liquid\nPurification Method: Antigen affinity purification\nUNIPROT ID: Q9GZT3\nStorage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.\nStorage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.","brand":"Proteintech","offers":[{"title":"Default Title","offer_id":46869385117865,"sku":"26006-1-AP","price":0.99,"currency_code":"USD","in_stock":true}],"url":"https:\/\/iright.com\/products\/proteintech-26006-1-ap","provider":"Iright","version":"1.0","type":"link"}