{"product_id":"proteintech-26020-1-ap","title":"Proteintech, 26020-1-AP, DHRS7C Polyclonal antibody","description":"Size: 20ul \/ 150ul\nThe DHRS7C (26020-1-AP) by Proteintech is a Polyclonal antibody targeting DHRS7C in WB, IHC, ELISA applications with reactivity to human, mouse, rat samples\n26020-1-AP targets DHRS7C in WB, IHC, ELISA applications and shows reactivity with human, mouse, rat samples.\n\u003cb\u003eTested Applications\u003c\/b\u003e\nPositive WB detected in: rat skeletal muscle tissue, mouse skeletal muscle tissue\nPositive IHC detected in: mouse skeletal muscle tissue, mouse heart tissueNote: suggested antigen retrieval withTE buffer pH 9.0;(*) Alternatively, antigen retrieval may be performed withcitrate buffer pH 6.0\n\u003cb\u003eRecommended dilution\u003c\/b\u003e\nWestern Blot (WB): WB : 1:500-1:3000\nImmunohistochemistry (IHC): IHC : 1:50-1:500\n\u003cb\u003eSpecification\u003c\/b\u003e\nTested Reactivity: human, mouse, rat\nHost \/ Isotype: Rabbit \/ IgG\nClass: Polyclonal\nType: Antibody\nImmunogen: CatNo: Ag23392 Product name: Recombinant human DHRS7C protein Source: e coli. -derived, PET28a Tag: 6*His Domain: 206-308 aa of BC147025 Sequence: VEEYDVVISTVSPTFIRSYHVYPEQGNWEASIWKFFFRKLTYGVHPVEVAEEVMRTVRRKKQEVFMANPIPKAAVYVRTFFPEFFFAVVACGVKEKLNVPEEG Predict reactive species\nFull Name: dehydrogenase\/reductase (SDR family) member 7C\nObserved Molecular Weight: 35 kDa\nGenBank Accession Number: BC147025\nGene Symbol: DHRS7C\nGene ID (NCBI): 201140\nRRID: AB_3085836\nConjugate: Unconjugated\nForm: Liquid\nPurification Method: Antigen affinity purification\nUNIPROT ID: A6NNS2\nStorage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.\nStorage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.","brand":"Proteintech","offers":[{"title":"Default Title","offer_id":46887186792617,"sku":"26020-1-AP","price":0.99,"currency_code":"USD","in_stock":true}],"url":"https:\/\/iright.com\/products\/proteintech-26020-1-ap","provider":"Iright","version":"1.0","type":"link"}