{"product_id":"proteintech-26050-1-ap","title":"Proteintech, 26050-1-AP, Complement factor D Polyclonal antibody","description":"Size: 20ul \/ 150ul\nThe Complement factor D (26050-1-AP) by Proteintech is a Polyclonal antibody targeting Complement factor D in WB, IHC, ELISA applications with reactivity to human samples\n26050-1-AP targets Complement factor D in WB, IHC, ELISA applications and shows reactivity with human samples.\n\u003cb\u003eTested Applications\u003c\/b\u003e\nPositive WB detected in: human plasma tissue, human placenta tissue,  human plasma\nPositive IHC detected in: human stomach tissueNote: suggested antigen retrieval withTE buffer pH 9.0;(*) Alternatively, antigen retrieval may be performed withcitrate buffer pH 6.0\n\u003cb\u003eRecommended dilution\u003c\/b\u003e\nWestern Blot (WB): WB : 1:500-1:1000\nImmunohistochemistry (IHC): IHC : 1:50-1:500\n\u003cb\u003eBackground Information\u003c\/b\u003e\nComplement factor D, also known as adipsin, is a highly specific serine protease. Complement factor D is the rate-limiting enzyme in the alternative pathway of complement. It activates C3 convertase by cleaving factor B, which is a key step in the alternative pathway. Complement factor D catalyzes the cleavage of factor B to generate Ba (non-catalytic chain) and Bb (active catalytic subunit), which together with C3(H2O) (or C3b) constitute the active C3 convertase C3(H2O)Bb (or C3bBb). (PMID: 34566967; PMID: 27775713).\n\u003cb\u003eSpecification\u003c\/b\u003e\nTested Reactivity: human\nCited Reactivity: human\nHost \/ Isotype: Rabbit \/ IgG\nClass: Polyclonal\nType: Antibody\nImmunogen: CatNo: Ag23473 Product name: Recombinant human CFD protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 87-201 aa of BC057807 Sequence: QPEPSKRLYDVLRAVPHPDSQPDTIDHDLLLLQLSEKATLGPAVRPLPWQRVDRDVAPGTLCDVAGWGIVNHAGRRPDSLQHVLLPVLDRATCNRRTHHDGAITERLMCAESNRR Predict reactive species\nFull Name: complement factor D (adipsin)\nCalculated Molecular Weight: 253 aa, 27 kDa\nObserved Molecular Weight: 27 kDa\nGenBank Accession Number: BC057807\nGene Symbol: CFD\nGene ID (NCBI): 1675\nRRID: AB_2880352\nConjugate: Unconjugated\nForm: Liquid\nPurification Method: Antigen affinity purification\nUNIPROT ID: P00746\nStorage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.\nStorage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.","brand":"Proteintech","offers":[{"title":"Default Title","offer_id":46869527134377,"sku":"26050-1-AP","price":0.99,"currency_code":"USD","in_stock":true}],"url":"https:\/\/iright.com\/products\/proteintech-26050-1-ap","provider":"Iright","version":"1.0","type":"link"}