{"product_id":"proteintech-26105-1-ap","title":"Proteintech, 26105-1-AP, RDX Polyclonal antibody","description":"Size: 20ul \/ 150ul\nThe RDX (26105-1-AP) by Proteintech is a Polyclonal antibody targeting RDX in WB, IF\/ICC, ELISA applications with reactivity to human, mouse, rat, monkey samples\n26105-1-AP targets RDX in WB, IF\/ICC, ELISA applications and shows reactivity with human, mouse, rat, monkey samples.\n\u003cb\u003eTested Applications\u003c\/b\u003e\nPositive WB detected in: COS-7 cells, HeLa cells,  Jurkat cells,  mouse liver tissue,  C6 cells,  mouse brain tissue,  mouse lung tissue,  rat brain tissue\nPositive IF\/ICC detected in: HeLa cells\n\u003cb\u003eRecommended dilution\u003c\/b\u003e\nWestern Blot (WB): WB : 1:1000-1:4000\nImmunofluorescence (IF)\/ICC: IF\/ICC : 1:50-1:500\n\u003cb\u003eSpecification\u003c\/b\u003e\nTested Reactivity: human, mouse, rat, monkey\nCited Reactivity: mouse\nHost \/ Isotype: Rabbit \/ IgG\nClass: Polyclonal\nType: Antibody\nImmunogen: CatNo: Ag23532 Product name: Recombinant human RDX protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 384-455 aa of BC047109 Sequence: EEAERLEKERRAAEEAKSAIAKQAADQMKNQEQLAAELAEFTAKIALLEEAKKKKEEEATEWQHKAFAAQED Predict reactive species\nFull Name: radixin\nCalculated Molecular Weight: 583 aa, 68 kDa\nObserved Molecular Weight: 70-75 kDa\nGenBank Accession Number: BC047109\nGene Symbol: RDX\nGene ID (NCBI): 5962\nRRID: AB_2880380\nConjugate: Unconjugated\nForm: Liquid\nPurification Method: Antigen affinity purification\nUNIPROT ID: P35241\nStorage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.\nStorage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.","brand":"Proteintech","offers":[{"title":"Default Title","offer_id":46869751529641,"sku":"26105-1-AP","price":0.99,"currency_code":"USD","in_stock":true}],"url":"https:\/\/iright.com\/products\/proteintech-26105-1-ap","provider":"Iright","version":"1.0","type":"link"}