{"product_id":"proteintech-26149-1-ap","title":"Proteintech, 26149-1-AP, Cytokeratin 71 Polyclonal antibody","description":"Size: 20ul \/ 150ul\nThe Cytokeratin 71 (26149-1-AP) by Proteintech is a Polyclonal antibody targeting Cytokeratin 71 in WB, ELISA applications with reactivity to human, mouse samples\n26149-1-AP targets Cytokeratin 71 in WB, ELISA applications and shows reactivity with human, mouse samples.\n\u003cb\u003eTested Applications\u003c\/b\u003e\nPositive WB detected in: mouse skin tissue\n\u003cb\u003eRecommended dilution\u003c\/b\u003e\nWestern Blot (WB): WB : 1:500-1:2000\n\u003cb\u003eBackground Information\u003c\/b\u003e\nKRT71 is a gene that encodes Keratin 71, a type II intermediate filament protein primarily expressed in the inner root sheath (IRS) of hair follicles. As a member of the keratin family, KRT71 plays a critical role in maintaining the structural integrity of hair shafts and follicular tissues. Mutations in this gene have been linked to hereditary hair disorders, including autosomal recessive woolly hair (ARWH) and hypotrichosis, characterized by abnormal hair texture, density, or growth patterns.\n\u003cb\u003eSpecification\u003c\/b\u003e\nTested Reactivity: human, mouse\nHost \/ Isotype: Rabbit \/ IgG\nClass: Polyclonal\nType: Antibody\nImmunogen: CatNo: Ag23536 Product name: Recombinant human KRT71 protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 450-523 aa of BC103917 Sequence: PVSISIISSTSGGSGYGFRPSMVSGGYVANSSNCISGVCSVRGGEGRSRGSANDYKDTLGKGSSLSAPSKKTSR Predict reactive species\nFull Name: keratin 71\nObserved Molecular Weight: 57 kDa\nGenBank Accession Number: BC103917\nGene Symbol: KRT71\nGene ID (NCBI): 112802\nRRID: AB_3085843\nConjugate: Unconjugated\nForm: Liquid\nPurification Method: Antigen affinity purification\nUNIPROT ID: Q3SY84\nStorage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.\nStorage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.","brand":"Proteintech","offers":[{"title":"Default Title","offer_id":46887054770345,"sku":"26149-1-AP","price":0.99,"currency_code":"USD","in_stock":true}],"url":"https:\/\/iright.com\/products\/proteintech-26149-1-ap","provider":"Iright","version":"1.0","type":"link"}