{"product_id":"proteintech-26161-1-ap","title":"Proteintech, 26161-1-AP, MCP-1\/CCL2 Polyclonal antibody","description":"Size: 20ul \/ 150ul\nThe MCP-1\/CCL2 (26161-1-AP) by Proteintech is a Polyclonal antibody targeting MCP-1\/CCL2 in WB, ELISA applications with reactivity to mouse samples\n26161-1-AP targets MCP-1\/CCL2 in WB, IHC, IF, ELISA applications and shows reactivity with mouse samples.\n\u003cb\u003eTested Applications\u003c\/b\u003e\nPositive WB detected in: LPS and Brefeldin A treated RAW 264.7 cells\n\u003cb\u003eRecommended dilution\u003c\/b\u003e\nWestern Blot (WB): WB : 1:500-1:2000\n\u003cb\u003eBackground Information\u003c\/b\u003e\nMonocyte chemoattractant protein-1 (MCP-1\/CCL2) is one of the key chemokines that regulate migration and infiltration of monocytes\/macrophages. Both CCL2 and its receptor CCR2 have been demonstrated to be induced and involved in various diseases. Migration of monocytes from the blood stream across the vascular endothelium is required for routine immunological surveillance of tissues, as well as in response to inflammation.\n\u003cb\u003eSpecification\u003c\/b\u003e\nTested Reactivity: mouse\nCited Reactivity: mouse, rat, bovine\nHost \/ Isotype: Rabbit \/ IgG\nClass: Polyclonal\nType: Antibody\nImmunogen: CatNo: Ag24085 Product name: Recombinant mouse Mcp1 protein Source: e coli. -derived, PET28a Tag: 6*His Domain: 24-148 aa of NM-011333 Sequence: QPDAVNAPLTCCYSFTSKMIPMSRLESYKRITSSRCPKEAVVFVTKLKREVCADPKKEWVQTYIKNLDRNQMRSEPTTLFKTASALRSSAPLNVKLTRKSEANASTTFSTTTSSTSVGVTSVTVN Predict reactive species\nFull Name: chemokine (C-C motif) ligand 2\nObserved Molecular Weight: 16-20 kDa\nGenBank Accession Number: NM-011333\nGene Symbol: MCP-1\/CCL2\nGene ID (NCBI): 20296\nRRID: AB_2918100\nConjugate: Unconjugated\nForm: Liquid\nPurification Method: Antigen affinity purification\nUNIPROT ID: P10148\nStorage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.\nStorage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.","brand":"Proteintech","offers":[{"title":"Default Title","offer_id":46868839465129,"sku":"26161-1-AP","price":0.99,"currency_code":"USD","in_stock":true}],"url":"https:\/\/iright.com\/products\/proteintech-26161-1-ap","provider":"Iright","version":"1.0","type":"link"}