{"product_id":"proteintech-26182-1-ap","title":"Proteintech, 26182-1-AP, SLC13A3 Polyclonal antibody","description":"Size: 20ul \/ 150ul\nThe SLC13A3 (26182-1-AP) by Proteintech is a Polyclonal antibody targeting SLC13A3 in WB, IHC, ELISA applications with reactivity to human, mouse samples\n26182-1-AP targets SLC13A3 in WB, IHC, ELISA applications and shows reactivity with human, mouse samples.\n\u003cb\u003eTested Applications\u003c\/b\u003e\nPositive WB detected in: mouse kidney tissue,  HEK-293 cells\nPositive IHC detected in: mouse kidney tissueNote: suggested antigen retrieval withTE buffer pH 9.0;(*) Alternatively, antigen retrieval may be performed withcitrate buffer pH 6.0\n\u003cb\u003eRecommended dilution\u003c\/b\u003e\nWestern Blot (WB): WB : 1:500-1:2000\nImmunohistochemistry (IHC): IHC : 1:50-1:500\n\u003cb\u003eBackground Information\u003c\/b\u003e\nSLC13A3, also named NADC3 and SDCT2, belongs to the SLC13A\/DASS transporter (TC 2.A.47) family and NADC subfamily. SLC13A3 encodes the plasma membrane Na+ \/Dicarboxylate Cotransporter 3 (NaDC3), which imports inside the cell four to six carbon dicarboxylates as well as N-acetylaspartate (NAA). SLC13A3 is mainly expressed in kidney, but also in brain, liver, placenta and eye (PMID: 30635937). This antibody detected the 55-60 kDa band in SDS-PAGE. However, the 55 kDa (nonglycosylated) and 85 kDa (glycosylated) bands have been reported in the article (PMID: 27053689).\n\u003cb\u003eSpecification\u003c\/b\u003e\nTested Reactivity: human, mouse\nCited Reactivity: human\nHost \/ Isotype: Rabbit \/ IgG\nClass: Polyclonal\nType: Antibody\nImmunogen: CatNo: Ag24183 Product name: Recombinant human SLC13A3 protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 568-602 aa of BC035966 Sequence: QTIFQLGTFPDWADMYSVNVTALPPTLANDTFRTL Predict reactive species\nFull Name: solute carrier family 13 (sodium-dependent dicarboxylate transporter), member 3\nCalculated Molecular Weight: 602 aa, 67 kDa\nObserved Molecular Weight: 55-60 kDa\nGenBank Accession Number: BC035966\nGene Symbol: SLC13A3\nGene ID (NCBI): 64849\nRRID: AB_2880414\nConjugate: Unconjugated\nForm: Liquid\nPurification Method: Antigen affinity purification\nUNIPROT ID: Q8WWT9\nStorage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.\nStorage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.","brand":"Proteintech","offers":[{"title":"Default Title","offer_id":46869601878185,"sku":"26182-1-AP","price":0.99,"currency_code":"USD","in_stock":true}],"url":"https:\/\/iright.com\/products\/proteintech-26182-1-ap","provider":"Iright","version":"1.0","type":"link"}