{"product_id":"proteintech-26223-1-ap","title":"Proteintech, 26223-1-AP, ASPM Polyclonal antibody","description":"Size: 20ul \/ 150ul\nThe ASPM (26223-1-AP) by Proteintech is a Polyclonal antibody targeting ASPM in WB, IHC, IF\/ICC, ELISA applications with reactivity to human samples\n26223-1-AP targets ASPM in WB, IHC, IF\/ICC, IP, CoIP, ELISA applications and shows reactivity with human samples.\n\u003cb\u003eTested Applications\u003c\/b\u003e\nPositive WB detected in: HEK-293T cells, K-562 cells\nPositive IHC detected in: human prostate cancer tissue, human gliomas tissue,  human ovary tumor tissueNote: suggested antigen retrieval withTE buffer pH 9.0;(*) Alternatively, antigen retrieval may be performed withcitrate buffer pH 6.0\nPositive IF\/ICC detected in: HeLa cells\n\u003cb\u003eRecommended dilution\u003c\/b\u003e\nWestern Blot (WB): WB : 1:500-1:1000\nImmunohistochemistry (IHC): IHC : 1:50-1:500\nImmunofluorescence (IF)\/ICC: IF\/ICC : 1:150-1:600\n\u003cb\u003eSpecification\u003c\/b\u003e\nTested Reactivity: human\nCited Reactivity: human, mouse\nHost \/ Isotype: Rabbit \/ IgG\nClass: Polyclonal\nType: Antibody\nImmunogen: CatNo: Ag24166 Product name: Recombinant human ASPM protein Source: e coli. -derived, PET30a Tag: 6*His Domain: 1-95 aa of BC034607 Sequence: MSLRAYTARCRLNRLRRAACRLFTSEKMVKAIKKLEIEIEARRLIVRKDRHLWKDVGERQKVLNWLLSYNPLWLRIGLETTYGELISLEDNSDVT Predict reactive species\nFull Name: asp (abnormal spindle) homolog, microcephaly associated (Drosophila)\nCalculated Molecular Weight: 410 kDa or 218 kDa\nObserved Molecular Weight: 218 kDa\nGenBank Accession Number: BC034607\nGene Symbol: ASPM\nGene ID (NCBI): 259266\nRRID: AB_2880431\nConjugate: Unconjugated\nForm: Liquid\nPurification Method: Antigen affinity purification\nUNIPROT ID: Q8IZT6\nStorage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.\nStorage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.","brand":"Proteintech","offers":[{"title":"Default Title","offer_id":46868880982185,"sku":"26223-1-AP","price":0.99,"currency_code":"USD","in_stock":true}],"url":"https:\/\/iright.com\/products\/proteintech-26223-1-ap","provider":"Iright","version":"1.0","type":"link"}