{"product_id":"proteintech-26228-1-ap","title":"Proteintech, 26228-1-AP, SCGB3A2 Polyclonal antibody","description":"Size: 20ul \/ 150ul\nThe SCGB3A2 (26228-1-AP) by Proteintech is a Polyclonal antibody targeting SCGB3A2 in IHC, IF-P, ELISA applications with reactivity to human, mouse, rat samples\n26228-1-AP targets SCGB3A2 in IHC, IF-P, ELISA applications and shows reactivity with human, mouse, rat samples.\n\u003cb\u003eTested Applications\u003c\/b\u003e\nPositive IHC detected in: human lung tissue, mouse lung tissue,  rat lung tissueNote: suggested antigen retrieval withTE buffer pH 9.0;(*) Alternatively, antigen retrieval may be performed withcitrate buffer pH 6.0\nPositive IF-P detected in: mouse lung tissue\n\u003cb\u003eRecommended dilution\u003c\/b\u003e\nImmunohistochemistry (IHC): IHC : 1:50-1:500\nImmunofluorescence (IF)-P: IF-P : 1:200-1:800\n\u003cb\u003eSpecification\u003c\/b\u003e\nTested Reactivity: human, mouse, rat\nCited Reactivity: human\nHost \/ Isotype: Rabbit \/ IgG\nClass: Polyclonal\nType: Antibody\nImmunogen: CatNo: Ag23969 Product name: Recombinant human SCGB3A2 protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 22-93 aa of BC024232 Sequence: FLINKVPLPVDKLAPLPLDNILPFMDPLKLLLKTLGISVEHLVEGLRKCVNELGPEASEAVKKLLEALSHLV Predict reactive species\nFull Name: secretoglobin, family 3A, member 2\nCalculated Molecular Weight: 10 kDa\nGenBank Accession Number: BC024232\nGene Symbol: SCGB3A2\nGene ID (NCBI): 117156\nRRID: AB_2880434\nConjugate: Unconjugated\nForm: Liquid\nPurification Method: Antigen affinity purification\nUNIPROT ID: Q96PL1\nStorage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.\nStorage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.","brand":"Proteintech","offers":[{"title":"Default Title","offer_id":46869761097897,"sku":"26228-1-AP","price":0.99,"currency_code":"USD","in_stock":true}],"url":"https:\/\/iright.com\/products\/proteintech-26228-1-ap","provider":"Iright","version":"1.0","type":"link"}