{"product_id":"proteintech-26236-1-ap","title":"Proteintech, 26236-1-AP, PDZD11 Polyclonal antibody","description":"Size: 20ul \/ 150ul\nThe PDZD11 (26236-1-AP) by Proteintech is a Polyclonal antibody targeting PDZD11 in IHC, ELISA applications with reactivity to human, mouse samples\n26236-1-AP targets PDZD11 in IHC, ELISA applications and shows reactivity with human, mouse samples.\n\u003cb\u003eTested Applications\u003c\/b\u003e\nPositive IHC detected in: mouse kidney tissueNote: suggested antigen retrieval withTE buffer pH 9.0;(*) Alternatively, antigen retrieval may be performed withcitrate buffer pH 6.0\n\u003cb\u003eRecommended dilution\u003c\/b\u003e\nImmunohistochemistry (IHC): IHC : 1:50-1:500\n\u003cb\u003eBackground Information\u003c\/b\u003e\nPDZ Domain Containing 11 (PDZD11), a small protein widely expressed in the body, is mainly comprised of a single PDZ domain. PDZD11 has often been reported to be associated with the adherens junction (AJ) of epithelial cells. PDZD11 binds nectins to the cadherin-and cytoskeleton-related protein complex by interacting with PLEKHA7 to stabilize the nexins at AJs and promotes efficient early assembly of junctions.(PMID: 38766598,PMID: 35714771)\n\u003cb\u003eSpecification\u003c\/b\u003e\nTested Reactivity: human, mouse\nHost \/ Isotype: Rabbit \/ IgG\nClass: Polyclonal\nType: Antibody\nImmunogen: CatNo: Ag23975 Product name: Recombinant human PDZD11 protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 69-140 aa of BC012996 Sequence: QLGIFISKVIPDSDAHRAGLQEGDQVLAVNDVDFQDIEHSKAVEILKTAREISMRVRFFPYNYHRQKERTVH Predict reactive species\nFull Name: PDZ domain containing 11\nGenBank Accession Number: BC012996\nGene Symbol: PDZD11\nGene ID (NCBI): 51248\nConjugate: Unconjugated\nForm: Liquid\nPurification Method: Antigen affinity purification\nUNIPROT ID: Q5EBL8\nStorage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.\nStorage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.","brand":"Proteintech","offers":[{"title":"Default Title","offer_id":46887756038313,"sku":"26236-1-AP","price":0.99,"currency_code":"USD","in_stock":true}],"url":"https:\/\/iright.com\/products\/proteintech-26236-1-ap","provider":"Iright","version":"1.0","type":"link"}