{"product_id":"proteintech-26244-1-ap","title":"Proteintech, 26244-1-AP, DLX2 Polyclonal antibody","description":"Size: 20ul \/ 150ul\nThe DLX2 (26244-1-AP) by Proteintech is a Polyclonal antibody targeting DLX2 in WB, IHC, ELISA applications with reactivity to human, mouse samples\n26244-1-AP targets DLX2 in WB, IHC, IF, CoIP, ELISA applications and shows reactivity with human, mouse samples.\n\u003cb\u003eTested Applications\u003c\/b\u003e\nPositive WB detected in: NIH\/3T3 cells\nPositive IHC detected in: mouse brain tissueNote: suggested antigen retrieval withTE buffer pH 9.0;(*) Alternatively, antigen retrieval may be performed withcitrate buffer pH 6.0\n\u003cb\u003eRecommended dilution\u003c\/b\u003e\nWestern Blot (WB): WB : 1:200-1:1000\nImmunohistochemistry (IHC): IHC : 1:50-1:500\n\u003cb\u003eBackground Information\u003c\/b\u003e\nDLX2, also named as Homeobox protein DLX-2, is a 328 amino acid protein, which contains 1 homeobox DNA-binding domain and belongs to the distal-less homeobox family. DLX2 localizes in the nucleus and is a Phosphoprotein. DLX2 likely to play a regulatory role in the development of the ventral forebrain and may play a role in craniofacial patterning and morphogenesis. The calcualted molecular weight of DLX2 is 34 kDa, but modified DLX2 is about 45-50 kDa. (PMID: 14769946)\n\u003cb\u003eSpecification\u003c\/b\u003e\nTested Reactivity: human, mouse\nCited Reactivity: human, mouse\nHost \/ Isotype: Rabbit \/ IgG\nClass: Polyclonal\nType: Antibody\nImmunogen: CatNo: Ag24663 Product name: Recombinant human DLX2 protein Source: e coli. -derived, PET30a Tag: 6*His Domain: 240-328 aa of BC032558 Sequence: SWDFGVPQRMAGGGGPGSGGSGAGSSGSSPSSAASAFLGNYPWYHQTSGSASHLQATAPLLHPTQTPQPHHHHHHHGGGGAPVSAGTIF Predict reactive species\nFull Name: distal-less homeobox 2\nCalculated Molecular Weight: 34 kDa\nObserved Molecular Weight: 45-50 kDa\nGenBank Accession Number: BC032558\nGene Symbol: DLX2\nGene ID (NCBI): 1746\nRRID: AB_2880444\nConjugate: Unconjugated\nForm: Liquid\nPurification Method: Antigen affinity purification\nUNIPROT ID: Q07687\nStorage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.\nStorage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.","brand":"Proteintech","offers":[{"title":"Default Title","offer_id":46869403369641,"sku":"26244-1-AP","price":0.99,"currency_code":"USD","in_stock":true}],"url":"https:\/\/iright.com\/products\/proteintech-26244-1-ap","provider":"Iright","version":"1.0","type":"link"}