{"product_id":"proteintech-26284-1-ap","title":"Proteintech, 26284-1-AP, SFR1 Polyclonal antibody","description":"Size: 20ul \/ 150ul\nThe SFR1 (26284-1-AP) by Proteintech is a Polyclonal antibody targeting SFR1 in WB, ELISA applications with reactivity to human samples\n26284-1-AP targets SFR1 in WB, ELISA applications and shows reactivity with human samples.\n\u003cb\u003eTested Applications\u003c\/b\u003e\nPositive WB detected in: HL-60 cells, Jurkat cells\n\u003cb\u003eRecommended dilution\u003c\/b\u003e\nWestern Blot (WB): WB : 1:1000-1:4000\n\u003cb\u003eBackground Information\u003c\/b\u003e\nThe SFR1 protein was initially discovered in the context of DNA homologous recombination repair, and its name originates from \"Swi6-interacting recombination repair protein 1.\" However, subsequent research has revealed its central role in the field of cell death, particularly in the process of **necroptosis**.\nIn the classical necroptosis signaling pathway, when cells receive death signals such as tumor necrosis factor, SFR1 is recruited and phosphorylated by the upstream kinase RIPK3 as a key adaptor protein. Phosphorylated SFR1 specifically binds to and stabilizes MLKL, the core executioner protein of necroptosis, significantly promoting the phosphorylation and subsequent activation of MLKL by RIPK3. This process ultimately leads to plasma membrane rupture and inflammatory cell death. Therefore, SFR1 is considered a critical molecule that precisely regulates the amplification and execution of necroptosis signaling. The study of its function is of great importance for understanding pathological processes such as infections, inflammatory diseases, and tissue damage.\n\u003cb\u003eSpecification\u003c\/b\u003e\nTested Reactivity: human\nHost \/ Isotype: Rabbit \/ IgG\nClass: Polyclonal\nType: Antibody\nImmunogen: CatNo: Ag23332 Product name: Recombinant human C10orf78 protein Source: e coli. -derived, PET28a Tag: 6*His Domain: 1-232 aa of BC140835 Sequence: MESPSDSAVVLPSTPQASANPSSPYTNSSRKQPMSATLRERLRKTRFSFNSSYNVVKRLKVESEENDQTFSEKPASSTEENCLEFQESFKHIDSEFEENTNLKNTLKNLNVCESQSLDSGSCSALQNEFVSEKLPKQRLNAEKAKLVKQVQEKEDLLRRLKLVKMYRSKNDLSQLQLLIKKWRSCSQLLLYELQSAVSEENKKLSLTQLIDHYGLDDKLLHYNRSEEEFIDV Predict reactive species\nFull Name: chromosome 10 open reading frame 78\nObserved Molecular Weight: 35, 36 kDa\nGenBank Accession Number: BC140835\nGene Symbol: C10orf78\nGene ID (NCBI): 119392\nConjugate: Unconjugated\nForm: Liquid\nPurification Method: Antigen affinity purification\nUNIPROT ID: Q86XK3\nStorage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.\nStorage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.","brand":"Proteintech","offers":[{"title":"Default Title","offer_id":46887798407337,"sku":"26284-1-AP","price":0.99,"currency_code":"USD","in_stock":true}],"url":"https:\/\/iright.com\/products\/proteintech-26284-1-ap","provider":"Iright","version":"1.0","type":"link"}