{"product_id":"proteintech-26302-1-ap","title":"Proteintech, 26302-1-AP, ZNF641 Polyclonal antibody","description":"Size: 20ul \/ 150ul\nThe ZNF641 (26302-1-AP) by Proteintech is a Polyclonal antibody targeting ZNF641 in WB, IF\/ICC, ELISA applications with reactivity to human, mouse , rat samples\n26302-1-AP targets ZNF641 in WB, IF\/ICC, ELISA applications and shows reactivity with human, mouse , rat samples.\n\u003cb\u003eTested Applications\u003c\/b\u003e\nPositive WB detected in: mouse skeletal muscle tissue\nPositive IF\/ICC detected in: A431 cells\n\u003cb\u003eRecommended dilution\u003c\/b\u003e\nWestern Blot (WB): WB : 1:500-1:1000\nImmunofluorescence (IF)\/ICC: IF\/ICC : 1:200-1:800\n\u003cb\u003eBackground Information\u003c\/b\u003e\nZinc finger protein 641(ZNF 641) encodes a zinc-finger protein with five different C2H2 type zinc fingers and a KRAB-A box. Northern blot analysis indicates that ZNF641 is expressed in most of the examined adult tissues, at a high level in skeletal muscle. The ZNF 641 protein contains 438 amino acids and has 4 isoforms (50,43,47,48 kDa) produced by alternative splicing.\n\u003cb\u003eSpecification\u003c\/b\u003e\nTested Reactivity: human, mouse , rat\nHost \/ Isotype: Rabbit \/ IgG\nClass: Polyclonal\nType: Antibody\nImmunogen: CatNo: Ag23672 Product name: Recombinant human ZNF641 protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 1-118 aa of BC018090 Sequence: MLSEQTAALGTRWESMNVQLDGAEPQVERGSQEERPWRTVPGPLEHLCCDLEEEPQSLQEKAQSAPWVPAIPQEGNTGDWEMAAALLAAGSQGLVTIKDVSLCFSQEEWRSLDPSQTD Predict reactive species\nFull Name: zinc finger protein 641\nObserved Molecular Weight: 40-45 kDa, 50-55 kDa\nGenBank Accession Number: BC018090\nGene Symbol: ZNF641\nGene ID (NCBI): 121274\nRRID: AB_3085853\nConjugate: Unconjugated\nForm: Liquid\nPurification Method: Antigen affinity purification\nUNIPROT ID: Q96N77\nStorage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.\nStorage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.","brand":"Proteintech","offers":[{"title":"Default Title","offer_id":46887951597737,"sku":"26302-1-AP","price":0.99,"currency_code":"USD","in_stock":true}],"url":"https:\/\/iright.com\/products\/proteintech-26302-1-ap","provider":"Iright","version":"1.0","type":"link"}