{"product_id":"proteintech-26330-1-ap","title":"Proteintech, 26330-1-AP, FAM134C Polyclonal antibody","description":"Size: 20ul \/ 150ul\nThe FAM134C (26330-1-AP) by Proteintech is a Polyclonal antibody targeting FAM134C in WB, IF\/ICC, ELISA applications with reactivity to human samples\n26330-1-AP targets FAM134C in WB, IF\/ICC, ELISA applications and shows reactivity with human samples.\n\u003cb\u003eTested Applications\u003c\/b\u003e\nPositive WB detected in: HEK-293T cells, HeLa cells,  HuH-7 cellls\nPositive IF\/ICC detected in: U2OS cells\n\u003cb\u003eRecommended dilution\u003c\/b\u003e\nWestern Blot (WB): WB : 1:500-1:1000\nImmunofluorescence (IF)\/ICC: IF\/ICC : 1:200-1:800\n\u003cb\u003eBackground Information\u003c\/b\u003e\nThe protein family with sequence similarity 134 (FAM134) comprises three proteins: FAM134B, FAM134A, and FAM134C. These proteins share the same LIR amino acid sequence. FAM134C, also known as the reticulophagy regulator 3 (RETREG3), plays a crucial role as an ER-phagy receptor. It is essential for maintaining ER morphology in a LC3-interacting region (LIR)-dependent manner.\n\u003cb\u003eSpecification\u003c\/b\u003e\nTested Reactivity: human\nHost \/ Isotype: Rabbit \/ IgG\nClass: Polyclonal\nType: Antibody\nImmunogen: CatNo: Ag23680 Product name: Recombinant human FAM134C protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 1-127 aa of BC049370 Sequence: MAEAEGVPTTPGPASGSTFRGRRDVSGSWERDQQVEAAQRALVEVLGPYEPLLSRVQAALVWERPARSALWCLGLNAAFWFFALTSLRLVFLLAFGLMIIVCIDQWKNKIWPEIKVPRPDALDNESW Predict reactive species\nFull Name: family with sequence similarity 134, member C\nObserved Molecular Weight: 65 kDa\nGenBank Accession Number: BC049370\nGene Symbol: FAM134C\nGene ID (NCBI): 162427\nRRID: AB_3085859\nConjugate: Unconjugated\nForm: Liquid\nPurification Method: Antigen affinity purification\nUNIPROT ID: Q86VR2\nStorage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.\nStorage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.","brand":"Proteintech","offers":[{"title":"Default Title","offer_id":46887631028393,"sku":"26330-1-AP","price":0.99,"currency_code":"USD","in_stock":true}],"url":"https:\/\/iright.com\/products\/proteintech-26330-1-ap","provider":"Iright","version":"1.0","type":"link"}