{"product_id":"proteintech-26344-1-ap","title":"Proteintech, 26344-1-AP, ZNF169 Polyclonal antibody","description":"Size: 20ul \/ 150ul\nThe ZNF169 (26344-1-AP) by Proteintech is a Polyclonal antibody targeting ZNF169 in WB, ELISA applications with reactivity to human,  mouse samples\n26344-1-AP targets ZNF169 in WB, ELISA applications and shows reactivity with human,  mouse samples.\n\u003cb\u003eTested Applications\u003c\/b\u003e\nPositive WB detected in: mouse small intestine tissue,  HeLa cells,  HepG2 cells,  mouse liver tissue\n\u003cb\u003eRecommended dilution\u003c\/b\u003e\nWestern Blot (WB): WB : 1:500-1:1000\n\u003cb\u003eBackground Information\u003c\/b\u003e\nZNF169 (Zinc finger protein 169) is a 603 amino acid nuclear protein that contains one KRAB domain and thirteen C2H2-type zinc fingers. ZNF169 is highly expressed in kidney and weakly expressed in spleen, liver, small intestine and heart, where it functions as a transcription regulator.\n\u003cb\u003eSpecification\u003c\/b\u003e\nTested Reactivity: human, mouse\nHost \/ Isotype: Rabbit \/ IgG\nClass: Polyclonal\nType: Antibody\nImmunogen: CatNo: Ag23805 Product name: Recombinant human ZNF169 protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 64-200 aa of BC047702 Sequence: NEHLLDLCPEPRTEFQPSFPHLVAFSSSQLLRQYALSGHPTQIFPSSSAGGDFQLEAPRCSSEKGESGETEGPDSSLRKRPSRISRTFFSPHQGDPVEWVEGNREGGTDLRLAQRMSLGGSDTMLKGADTSESGAVI Predict reactive species\nFull Name: zinc finger protein 169\nObserved Molecular Weight: 68 kDa\nGenBank Accession Number: BC047702\nGene Symbol: ZNF169\nGene ID (NCBI): 169841\nRRID: AB_2880484\nConjugate: Unconjugated\nForm: Liquid\nPurification Method: Antigen affinity purification\nUNIPROT ID: Q14929\nStorage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.\nStorage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.","brand":"Proteintech","offers":[{"title":"Default Title","offer_id":46887939211433,"sku":"26344-1-AP","price":0.99,"currency_code":"USD","in_stock":true}],"url":"https:\/\/iright.com\/products\/proteintech-26344-1-ap","provider":"Iright","version":"1.0","type":"link"}