{"product_id":"proteintech-26385-1-ap","title":"Proteintech, 26385-1-AP, DDX5 Polyclonal antibody","description":"Size: 20ul \/ 150ul\nThe DDX5 (26385-1-AP) by Proteintech is a Polyclonal antibody targeting DDX5 in WB, IHC, IF\/ICC, IP, ELISA applications with reactivity to human, rat, mouse samples\n26385-1-AP targets DDX5 in WB, IHC, IF\/ICC, IP, ELISA applications and shows reactivity with human, rat, mouse samples.\n\u003cb\u003eTested Applications\u003c\/b\u003e\nPositive WB detected in: HepG2 cells,  HeLa cells\nPositive IP detected in: HeLa cells\nPositive IHC detected in: mouse liver tissue, rat kidney tissueNote: suggested antigen retrieval withTE buffer pH 9.0;(*) Alternatively, antigen retrieval may be performed withcitrate buffer pH 6.0\nPositive IF\/ICC detected in: HepG2 cells\n\u003cb\u003eRecommended dilution\u003c\/b\u003e\nWestern Blot (WB): WB : 1:500-1:2000\nImmunoprecipitation (IP): IP : 0.5-4.0 ug for 1.0-3.0 mg of total protein lysate\nImmunohistochemistry (IHC): IHC : 1:400-1:1600\nImmunofluorescence (IF)\/ICC: IF\/ICC : 1:50-1:500\n\u003cb\u003eBackground Information\u003c\/b\u003e\nDDX5 or p68, a member of DEAD\/H BOX, which has a characteristic DEAD box, is a proliferation-associated nuclear antigen. DDX5 involves in the alternative regulation of pre-mRNA splicing, act as a RNA helicase to increase tau exon10 inclusion in a RBM4-dependent manner. It's also a transcription coactivator for extrogen receptor ESR1 and androgen receptor AR. Once synergized with DDX17 and SRA1 RNA, DDX5 activated MYOD1 transcription activity and involved in skeletal muscle differentiation.\n\u003cb\u003eSpecification\u003c\/b\u003e\nTested Reactivity: human, rat, mouse\nCited Reactivity: human\nHost \/ Isotype: Rabbit \/ IgG\nClass: Polyclonal\nType: Antibody\nImmunogen: CatNo: Ag24821 Product name: Recombinant human DDX5 protein Source: e coli. -derived, PET28a Tag: 6*His Domain: 434-614 aa of NM_004396 Sequence: RSTKTGTAYTFFTPNNIKQVSDLISVLREANQAINPKLLQLVEDRGSGRSRGRGGMKDDRRDRYSAGKRGGFNTFRDRENYDRGYSSLLKRDFGAKTQNGVYSAANYTNGSFGSNFVSAGIQTSFRTGNPTGTYQNGYDSTQQYGSNVPNMHNGMNQQAYAYPATAAAPMIGYPMPTGYSQ Predict reactive species\nFull Name: DEAD (Asp-Glu-Ala-Asp) box polypeptide 5\nObserved Molecular Weight: 69 kDa\nGenBank Accession Number: NM_004396\nGene Symbol: DDX5\nGene ID (NCBI): 1655\nRRID: AB_2880498\nConjugate: Unconjugated\nForm: Liquid\nPurification Method: Antigen affinity purification\nUNIPROT ID: P17844\nStorage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.\nStorage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.","brand":"Proteintech","offers":[{"title":"Default Title","offer_id":46869530149033,"sku":"26385-1-AP","price":0.99,"currency_code":"USD","in_stock":true}],"url":"https:\/\/iright.com\/products\/proteintech-26385-1-ap","provider":"Iright","version":"1.0","type":"link"}