{"product_id":"proteintech-26411-1-ap","title":"Proteintech, 26411-1-AP, Pan-Keratin Polyclonal antibody","description":"Size: 20ul \/ 150ul\nThe Pan-Keratin (26411-1-AP) by Proteintech is a Polyclonal antibody targeting Pan-Keratin in WB, IHC, IF\/ICC, IF-P, ELISA applications with reactivity to human, mouse samples\n26411-1-AP targets Pan-Keratin in WB, IHC, IF\/ICC, IF-P, ELISA applications and shows reactivity with human, mouse samples.\n\u003cb\u003eTested Applications\u003c\/b\u003e\nPositive WB detected in: A431 cells, MCF-7 cells,  HeLa cells\nPositive IHC detected in: human oesophagus tissue, human brown disease,  human cervical cancer tissue,  human colon cancer tissue,  human liver tissue,  human lung cancer tissue,  human renal cell carcinoma tissue,  human tonsillitis tissueNote: suggested antigen retrieval withTE buffer pH 9.0;(*) Alternatively, antigen retrieval may be performed withcitrate buffer pH 6.0\nPositive IF-P detected in: human colon cancer tissue, human rectal cancer tissue\nPositive IF\/ICC detected in: A431 cells, HeLa cells,  mouse breast cancer\n\u003cb\u003eRecommended dilution\u003c\/b\u003e\nWestern Blot (WB): WB : 1:50000-1:200000\nImmunohistochemistry (IHC): IHC : 1:1500-1:6000\nImmunofluorescence (IF)-P: IF-P : 1:200-1:800\nImmunofluorescence (IF)\/ICC: IF\/ICC : 1:50-1:500\n\u003cb\u003eBackground Information\u003c\/b\u003e\nPan-keratin, also known as pan-cytokeratin, refers to a group of antibodies that recognize a broad array of keratin proteins. Keratins are a large family of intermediate filament (IF) proteins that provide structural integrity to epithelial cells. These proteins are essential for maintaining cell shape, strength, and resilience\n. The keratin gene family is divided into two major groups: type I keratins (acidic) and type II keratins (basic), with 27 type I and 26 type II keratin genes in humans.  Pan-keratin immunostaining is widely used in pathology and research due to its ability to detect a variety of keratin proteins, making it a valuable tool for identifying epithelial cells and tissues. This staining technique is particularly useful in the diagnosis of tumors, as it can help distinguish between epithelial and non-epithelial neoplasms. This antibody is a pan-keratin antibody.\n\u003cb\u003eSpecification\u003c\/b\u003e\nTested Reactivity: human, mouse\nCited Reactivity: human, mouse, rat, sheep\nHost \/ Isotype: Rabbit \/ IgG\nClass: Polyclonal\nType: Antibody\nImmunogen: CatNo: Ag24184 Product name: Recombinant human KRT5 protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 316-491 aa of BC024292 Sequence: THVSDTSVVLSMDNNRNLDLDSIIAEVKAQYEEIANRSRTEAESWYQTKYEELQQTAGRHGDDLRNTKHEISEMNRMIQRLRAEIDNVKKQCANLQNAIADAEQRGELALKDARNKLAELEEALQKAKQDMARLLREYQELMNTKLALDVEIATYRKLLEGEECRLSGEGVGPVNI Predict reactive species\nFull Name: keratin 5\nCalculated Molecular Weight: 590 aa, 62 kDa\nObserved Molecular Weight: 46-58 kDa\nGenBank Accession Number: BC024292\nGene Symbol: Cytokeratin 5\nGene ID (NCBI): 3852\nRRID: AB_2880505\nConjugate: Unconjugated\nForm: Liquid\nPurification Method: Antigen affinity purification\nUNIPROT ID: P13647\nStorage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.\nStorage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.","brand":"Proteintech","offers":[{"title":"Default Title","offer_id":46868841726121,"sku":"26411-1-AP","price":0.99,"currency_code":"USD","in_stock":true}],"url":"https:\/\/iright.com\/products\/proteintech-26411-1-ap","provider":"Iright","version":"1.0","type":"link"}