{"product_id":"proteintech-26424-1-ap","title":"Proteintech, 26424-1-AP, LHCGR Polyclonal antibody","description":"Size: 20ul \/ 150ul\nThe LHCGR (26424-1-AP) by Proteintech is a Polyclonal antibody targeting LHCGR in WB, IHC, IF-P, ELISA applications with reactivity to human, mouse samples\n26424-1-AP targets LHCGR in WB, IHC, IF-P, ELISA applications and shows reactivity with human, mouse samples.\n\u003cb\u003eTested Applications\u003c\/b\u003e\nPositive WB detected in: mouse ovary tissue\nPositive IHC detected in: human ovary cancer tissue, human ovary tissue,  human thyroid cancer tissue,  mouse ovary tissueNote: suggested antigen retrieval withTE buffer pH 9.0;(*) Alternatively, antigen retrieval may be performed withcitrate buffer pH 6.0\nPositive IF-P detected in: mouse ovary tissue\n\u003cb\u003eRecommended dilution\u003c\/b\u003e\nWestern Blot (WB): WB : 1:500-1:2000\nImmunohistochemistry (IHC): IHC : 1:100-1:4000\nImmunofluorescence (IF)-P: IF-P : 1:50-1:500\n\u003cb\u003eBackground Information\u003c\/b\u003e\nLHCGR, also known as LHR or LSHR, belongs to the rhodopsin-like family of G protein-coupled receptors (GPCRs) and plays a crucial role in the regulation of gonadal functions by stimulating steroidogenesis in response to luteinizing hormone (LH) or hCG (PMID: 15866423). Mutations in LHCGR gene result in familial male-limited precocious puberty, Leydig cell hypoplasia, and empty follicle syndrome (PMID: 30711030). LHCGR protein consists of 699 amino acids with a calculated molecular weight of 79 kDa. Due to massive glycosylation, the molecular mass of the mature LHCGR is higher (85-100 kDa) than the predicted molecular protein mass of 79 kDa (PMID: 23686864; 15866423; 29075189; 15969756).\n\u003cb\u003eSpecification\u003c\/b\u003e\nTested Reactivity: human, mouse\nCited Reactivity: mouse\nHost \/ Isotype: Rabbit \/ IgG\nClass: Polyclonal\nType: Antibody\nImmunogen: CatNo: Ag19259 Product name: Recombinant human LHCGR protein Source: e coli. -derived, PET28a Tag: 6*His Domain: 49-219 aa of BC157028 Sequence: AGLTRLSLAYLPVKVIPSQAFRGLNEVIKIEISQIDSLERIEANAFDNLLNLSEILIQNTKNLRYIEPGAFINLPRLKYLSICNTGIRKFPDVTKVFSSESNFILEICDNLHITTIPGNAFQGMNNESVTLKLYGNGFEEVQSHAFNGTTLTSLELKENVHLEKMHNGAFR Predict reactive species\nFull Name: LHCGR\nCalculated Molecular Weight: 699 aa, 79 kDa\nObserved Molecular Weight: 100 kDa\nGenBank Accession Number: BC157028\nGene Symbol: LHCGR\nGene ID (NCBI): 3973\nRRID: AB_2880511\nConjugate: Unconjugated\nForm: Liquid\nPurification Method: Antigen affinity purification\nUNIPROT ID: P22888\nStorage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.\nStorage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.","brand":"Proteintech","offers":[{"title":"Default Title","offer_id":46869469397161,"sku":"26424-1-AP","price":0.99,"currency_code":"USD","in_stock":true}],"url":"https:\/\/iright.com\/products\/proteintech-26424-1-ap","provider":"Iright","version":"1.0","type":"link"}